KEGG   Orcinus orca (killer whale): 101281145Help
Entry
101281145         CDS       T05247                                 

Gene name
MECR
Definition
(RefSeq) trans-2-enoyl-CoA reductase, mitochondrial
  KO
K07512  mitochondrial enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase [EC:1.3.1.- 1.3.1.38]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00061  Fatty acid biosynthesis
oor00062  Fatty acid elongation
oor01100  Metabolic pathways
oor01212  Fatty acid metabolism
Module
oor_M00085  Fatty acid elongation in mitochondria
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101281145 (MECR)
   00062 Fatty acid elongation
    101281145 (MECR)
Enzymes [BR:oor01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.38  trans-2-enoyl-CoA reductase (NADPH)
     101281145 (MECR)
    1.3.1.-  
     101281145 (MECR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 PALP UIM
Motif
Other DBs
NCBI-GeneID: 101281145
NCBI-ProteinID: XP_004266613
LinkDB All DBs
Position
Unknown
AA seq 384 aa AA seqDB search
MTYLTASGSELTGGSMWVCGARTPAQLRRRLFPAFRRRPPAAAAFSASAEPSRVRALVYG
HHGDPAKVVELKNLELAAVGGSDVHVKMLAAPVNPSDINMIQGNYGLLPKLPAVGGNEGV
GQVVAVGSSVTRVKPGDWVIPANAGLGTWRTEAVFSEEALISVPSDIPLQSAATLGVNPC
TAYRMLMDFEQLRPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLTDRLK
NLGAHHVVTEEELRKHEMKNFFKDVPQPQLALNCVGGKSSTELLRHLAPGGTMVTYGGMA
KQPVIASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIHRGQLTAPACSEVP
LQDYQRALEASMQPFVSSKQILTM
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgacgtatctcacagcgtcaggctctgagttaaccggaggaagcatgtgggtctgcggg
gcgcgaaccccggctcagctgcggcggcggctgttccccgcgttccgccgccggccacct
gctgccgccgccttctccgcatctgccgagccctcccgggtccgggcgctggtctatggg
caccacggggacccagccaaggtcgtcgaactgaagaacctggagctggctgctgtgggc
ggatcagacgtccatgtgaagatgctggcagcccctgtcaatccatctgacattaatatg
atccaaggaaattatggcctccttcccaagctgcctgccgttggagggaatgaaggtgtt
ggacaggtcgtagcagtgggcagcagtgtgaccagggtgaagccaggagactgggtgatt
ccagcgaatgctggtttgggaacctggcgaaccgaggctgtgttcagcgaggaagcgctc
atctcggttccgagtgacatccctcttcagagcgccgccaccctgggcgtcaatccctgt
acggcctaccggatgctgatggacttcgagcagctgcggccaggggattctgtcatccag
aatgcatccaacagtggagtggggcaagcagtcatccagatcgccgcagccctgggcctg
aggaccatcaacgtggtccgagacagacctgacatccagaagctgaccgacagactgaag
aatctgggggcccatcatgttgtcacagaagaggaactaagaaagcatgagatgaaaaac
ttctttaaggacgtgccccagcctcagcttgctctcaactgtgtcggcgggaaaagctcc
acggagctgctgcggcacttggcgcctggaggaaccatggtgacctatggggggatggcc
aagcagcctgtcatcgcctctgtgagcctgctcatttttaaggatctcaaacttcggggc
ttttggttatcccagtggaagaaggaccacagtccagaccagttcaaggagctgatcctc
acgctgtgcgatctcatccaccgaggccagctcacggcccctgcctgctccgaggtccca
ctgcaggactaccagcgtgccttagaagcgtccatgcagcctttcgtgtcttccaagcag
atcctcaccatgtga

DBGET integrated database retrieval system