KEGG   Orcinus orca (killer whale): 101281303Help
Entry
101281303         CDS       T05247                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor-associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04010  MAPK signaling pathway
oor04064  NF-kappa B signaling pathway
oor04071  Sphingolipid signaling pathway
oor04141  Protein processing in endoplasmic reticulum
oor04210  Apoptosis
oor04217  Necroptosis
oor04380  Osteoclast differentiation
oor04621  NOD-like receptor signaling pathway
oor04622  RIG-I-like receptor signaling pathway
oor04657  IL-17 signaling pathway
oor04668  TNF signaling pathway
oor04920  Adipocytokine signaling pathway
oor04932  Non-alcoholic fatty liver disease (NAFLD)
oor05010  Alzheimer disease
oor05016  Huntington disease
oor05017  Spinocerebellar ataxia
oor05132  Salmonella infection
oor05135  Yersinia infection
oor05160  Hepatitis C
oor05163  Human cytomegalovirus infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05168  Herpes simplex virus 1 infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101281303 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101281303 (TRAF2)
   04064 NF-kappa B signaling pathway
    101281303 (TRAF2)
   04668 TNF signaling pathway
    101281303 (TRAF2)
   04071 Sphingolipid signaling pathway
    101281303 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101281303 (TRAF2)
   04217 Necroptosis
    101281303 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101281303 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    101281303 (TRAF2)
   04657 IL-17 signaling pathway
    101281303 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101281303 (TRAF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101281303 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101281303 (TRAF2)
   05203 Viral carcinogenesis
    101281303 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101281303 (TRAF2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101281303 (TRAF2)
   05016 Huntington disease
    101281303 (TRAF2)
   05017 Spinocerebellar ataxia
    101281303 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101281303 (TRAF2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101281303 (TRAF2)
   05135 Yersinia infection
    101281303 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101281303 (TRAF2)
   05160 Hepatitis C
    101281303 (TRAF2)
   05168 Herpes simplex virus 1 infection
    101281303 (TRAF2)
   05163 Human cytomegalovirus infection
    101281303 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101281303 (TRAF2)
   05169 Epstein-Barr virus infection
    101281303 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:oor03019]
    101281303 (TRAF2)
   04121 Ubiquitin system [BR:oor04121]
    101281303 (TRAF2)
Enzymes [BR:oor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101281303 (TRAF2)
Messenger RNA biogenesis [BR:oor03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     101281303 (TRAF2)
Ubiquitin system [BR:oor04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    101281303 (TRAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-RING_6 zf-C3HC4_4
Motif
Other DBs
NCBI-GeneID: 101281303
NCBI-ProteinID: XP_004285014
LinkDB All DBs
Position
Unknown
AA seq 516 aa AA seqDB search
MAAASATPPGSLDLLQPGFSKTLLGTKLEDKYLCSACRNVLRRPFQAQCGHRYCSFCLSS
ILSSGPQNCAACVNEGIYEEGVSILESSSAFPDNAARREVESLPAVCSSEGCTWKGTLKE
YESCHEGHCPFVLTECPACKGLVRLGEKEHHLEHACPERSLSCRHCRAPCCSADMKAHHQ
VCPKFPLTCEGCGKKKITREKFQDHVRTCGRCRVPCRFHAVGCPEMVEGERLQEHEAQRL
REHLALLLGALLEAGPPLLSQGEQGWGASTPGPGAAPSQAAELLQRCEALERKTATFENI
VCVLNREVERVAVTAEACGRQHRLDQDRIEALSNKVQQLERSIGLKDLAMADLEQKVHEM
EASTFDGVFIWKIPDFARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRAYLNGDGTGRGT
HLSLFFVLMKGPHDALLHWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVSDMNI
ASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagccagcgcgacccctcccggctccctggacctgctgcagcctggcttctcc
aagaccctcctggggaccaagctagaggacaagtacctgtgctcggcctgcaggaacgtc
ctgcgcaggcccttccaggctcagtgtggccaccgctactgttccttctgcttgagcagc
atcttgagctccgggccccagaactgtgccgcctgcgtgaacgagggcatttacgaggaa
ggcgtctctatcctggagagcagctcggctttcccggacaatgctgcccgcagggaggta
gagagcctgccggccgtctgttccagcgagggctgcacctggaaggggaccctgaaggag
tacgagagctgccacgaaggacactgcccgttcgtgctgaccgagtgcccggcgtgtaaa
ggcctggtgcgcctgggcgagaaggaacaccacctggagcacgcgtgcccggagcgaagc
ctcagctgccggcactgcagggcgccctgctgctcggccgacatgaaggcgcaccaccag
gtctgccccaagttccccttgacctgcgagggctgcggcaagaagaagatcacacgcgag
aaatttcaggaccacgtcaggacatgtggcagatgccgagtcccctgcaggttccacgct
gtcggctgccccgagatggtggagggcgagaggctgcaggagcacgaggcgcagcggctc
cgggagcacctggccctgcttctgggcgccctcctggaggccgggccccccctcctcagc
cagggcgagcagggctggggggccagcacgccaggcccgggggcagcgccctcccaggcg
gcggagctgctgcagaggtgcgaggccctggagcggaagacggccaccttcgagaacatc
gtctgcgtgctgaaccgggaggtggagcgggtggccgtgactgccgaggcctgcggccgg
cagcaccggctggaccaagacaggatcgaagccctgagtaataaggtgcagcagctggag
aggagcatcggcctgaaggacctggccatggccgacctggagcagaaggtccacgagatg
gaggcgtccaccttcgacggggtgttcatctggaagatcccggacttcgccaggaagcgc
caggaagctgtggctggccgcacgcccgccatcttctctccagccttctacaccagcagg
tacggctacaagatgtgtctgcgcgcctacctgaacggagatggcactgggcgcgggacg
cacctgtccctcttcttcgttctgatgaagggcccccacgacgccctcctgcactggccc
ttcaaccagaaggtgaccctgatgttgctggaccagaacaaccgggagcatgtgattgac
gccttcaggcccgacgtgacctcatcctcgttccagaggccggtcagcgacatgaacatc
gcaagcggctgcccgcttttctgccccgtctccaagatggaggccaagaattcctacgtg
cgtgacgacgccatcttcatcaaggccatagtggacctgacagggctctag

DBGET integrated database retrieval system