KEGG   Orcinus orca (killer whale): 101281424
Entry
101281424         CDS       T05247                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04915  Estrogen signaling pathway
oor05200  Pathways in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05223  Non-small cell lung cancer
oor05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101281424 (TGFA)
   04012 ErbB signaling pathway
    101281424 (TGFA)
   04014 Ras signaling pathway
    101281424 (TGFA)
   04151 PI3K-Akt signaling pathway
    101281424 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101281424 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101281424 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101281424 (TGFA)
   05212 Pancreatic cancer
    101281424 (TGFA)
   05225 Hepatocellular carcinoma
    101281424 (TGFA)
   05214 Glioma
    101281424 (TGFA)
   05211 Renal cell carcinoma
    101281424 (TGFA)
   05215 Prostate cancer
    101281424 (TGFA)
   05223 Non-small cell lung cancer
    101281424 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101281424 (TGFA)
SSDB
Motif
Pfam: EGF_2 EGF TMEM154
Other DBs
NCBI-GeneID: 101281424
NCBI-ProteinID: XP_004277090
LinkDB
Position
Unknown
AA seq 160 aa
MVTSAGQLALFVLGLLLAVCQALENSSSALSADPPVAAAVVSHFNDCPASHSQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALTVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggttacctcggctggacagctcgccctcttcgtgctgggtcttctgttggctgtgtgc
caggccctggagaacagttcgtccgctctgagtgcagacccacccgtggccgcagctgtg
gtgtcccattttaatgactgccctgcttcccacagtcagttctgcttccatggaacctgc
aggtttttggtgcaggaggacaagccagcatgtgtctgccactctgggtacgtcggtgca
cgctgtgaacacgcggacctcctggccgtggtggccgccagccagaagaagcaggccatt
actgccttggtggtggtctccatcgtggccctgactgtcctcatcatcacgtgtgtgctg
atacactgctgccaggtccgaaaacactgtgaatggtgccgggccctcatctgccggcac
gagaagcccagtgccctcctgaagggaaggactgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system