KEGG   Orcinus orca (killer whale): 101281976
Entry
101281976         CDS       T05247                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04114  Oocyte meiosis
oor04140  Autophagy - animal
oor04144  Endocytosis
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04152  AMPK signaling pathway
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04510  Focal adhesion
oor04520  Adherens junction
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04730  Long-term depression
oor04913  Ovarian steroidogenesis
oor04914  Progesterone-mediated oocyte maturation
oor05200  Pathways in cancer
oor05202  Transcriptional misregulation in cancer
oor05205  Proteoglycans in cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05218  Melanoma
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101281976 (IGF1R)
   04014 Ras signaling pathway
    101281976 (IGF1R)
   04015 Rap1 signaling pathway
    101281976 (IGF1R)
   04066 HIF-1 signaling pathway
    101281976 (IGF1R)
   04068 FoxO signaling pathway
    101281976 (IGF1R)
   04151 PI3K-Akt signaling pathway
    101281976 (IGF1R)
   04152 AMPK signaling pathway
    101281976 (IGF1R)
   04150 mTOR signaling pathway
    101281976 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101281976 (IGF1R)
   04140 Autophagy - animal
    101281976 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101281976 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101281976 (IGF1R)
   04520 Adherens junction
    101281976 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    101281976 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    101281976 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    101281976 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    101281976 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    101281976 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    101281976 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101281976 (IGF1R)
   05202 Transcriptional misregulation in cancer
    101281976 (IGF1R)
   05205 Proteoglycans in cancer
    101281976 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101281976 (IGF1R)
   05214 Glioma
    101281976 (IGF1R)
   05218 Melanoma
    101281976 (IGF1R)
   05215 Prostate cancer
    101281976 (IGF1R)
   05224 Breast cancer
    101281976 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101281976 (IGF1R)
   01522 Endocrine resistance
    101281976 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101281976 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oor04090]
    101281976 (IGF1R)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101281976 (IGF1R)
Protein kinases [BR:oor01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   101281976 (IGF1R)
CD molecules [BR:oor04090]
 Proteins
  101281976 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD DUF4476
Other DBs
NCBI-GeneID: 101281976
NCBI-ProteinID: XP_004271707
LinkDB
Position
Unknown
AA seq 1367 aa
MKSGSGGGSPTSLWGLLFFSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPLCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENHECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPSCPPNTYRFEGWRCVDRDFCANIPNAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRQILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTWKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDAEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDSYLYRH
NYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNAIFVPRPERKRREVMQVANTTMSSRNRNTTVVDTYNITDPEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTTYENFIHLIIALPIAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSIKDEMEPGFREVSFYYSEENKPPEPEELDLEPENMESVPLDPSASSSSLPLPDRH
SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKKERALPLPQSSTC
NT seq 4104 nt   +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcctatttttctcc
gccgcgctctcgctctggccgacgagtggagaaatctgtgggccaggcatcgacatccgc
aacgactaccagcagctgaagcggctggagaactgcacggtgatcgagggctacctccac
atcctgctcatttccaaggctgaggactaccgcagctaccgctttcccaagctcacggtc
atcactgagtacctgctgctgttccgcgtggccggcctcgagagcctcggtgacctcttc
cccaacctcacagtcatccgtggctggaagctcttctacaactacgccctggtcatcttc
gagatgaccaacctcaaggatattgggctctacaacctgcgaaacattacccgtggggcc
atccggatcgagaagaatgctgacctctgctacctctccacggtggactggtccctaatc
ctggatgctgtgtccaataactacatcgtggggaataagcccccaaaggagtgtggggac
ctgtgcccggggacgatggaggagaagccgctgtgcgagaagacgaccatcaacaacgag
tacaactaccgctgctggaccacgaaccgctgtcagaaaatgtgcccgagcacgtgcggg
aagcgggcgtgcacggagaaccacgagtgctgccaccccgagtgcctgggcagctgcagc
gcgcccgacaacgacacggcctgcgtggcctgccgccactactactatgccggtgtctgt
gtgcccagctgcccgcccaacacctaccgcttcgagggctggcgttgtgtggaccgtgac
ttctgcgccaacatccccaacgctgagagcagcgattccgagggcttcgtgatccacgac
ggcgagtgcatgcaggagtgcccgtcgggcttcatccgcaacggcagccagagcatgtac
tgcatcccttgcgaaggcccttgtcccaaagtgtgtgaggaagagaaaaagacaaagacc
attgattctgtcacttctgctcagatgctccaaggatgcaccatcttcaagggcaatcta
ctcattaatatccgacgcggcaacaacatcgcttcggaactggagaacttcatgggactc
atcgaggtcgtgacgggctacgtgaagatccgccactcccatgccttggtctccttgtcc
ttcctgaagaaccttcgccagatcctaggagaggagcaactagaggggaattactccttc
tacgtcctcgacaaccagaacttgcagcagctgtgggactgggaccaccgcaacctgacc
atcaaagccgggaaaatgtactttgctttcaatcccaaattgtgtgtctccgagatttac
cgcatggaggaagtgacggggactaaagggcgccagagcaaaggggacataaacaccagg
aacaacggagagagagcctcctgtgaaagtgacgtcctgcacttcacctccaccaccacg
tggaagaaccgcatcatcatcacctggcaccggtaccggccccctgactacagggacctc
atcagcttcaccgtctactacaaggaagcaccctttaaaaacgtcacagagtatgacggg
caggatgcctgtggctccaacagctggaacatggtagatgtggacctcccacccaacaag
gacgcggagcccggcattttactgcatggactgaagccctggacacagtatgccgtttac
gtcaaggctgtgaccctcaccatggtggagaatgaccacatccgtggagccaagagtgag
atcttgtacattcgcaccaacgcttcagttccttccatccccctggatgtactctcagca
tcaaactcctcctctcagctgatcgtgaagtggaaccctccttccctgcccaacggcaac
ctgagctactacatcgtaaggtggcagcgccagccccaggacagctacctttaccggcat
aattactgctccaaagacaaaatccccatcaggaagtacgccgatggcaccatcgacgtt
gaggaggtgacggagaatcccaagaccgaagtgtgtggtggggagaaagggccgtgctgc
gcttgccccaaaaccgaagccgagaagcaggccgagaaggaggaggccgagtaccgcaag
gtcttcgagaatttcctgcacaacgccatcttcgtgcccagacctgaacggaagcggagg
gaggtcatgcaggtcgccaacaccaccatgtccagccggaacaggaacaccacggtggtg
gacacctacaacatcacagacccggaagagctcgagaccgagtaccctttcttcgagagc
agagtggataacaaggagagaactgtcatctccaacctccggccttttactctgtaccga
atcgatatccacagctgtaaccacgaagctgagaagcttggctgcagtgcctccaacttt
gtctttgcaagaaccatgcctgcagaaggagcagatgacattcctgggccagtgacctgg
gagccaaggcctgagaactccatctttttaaaatggccagaacctgagaatcccaatgga
ttgattttaatgtacgaaataaaatatggatcacaagtcgaggatcagcgggaatgtgtg
tccagacaggagtacaggaagtatggaggggccaagctaaaccggctcaacccggggaac
tacacggcccggatccaggccacctctctctctgggaacgggtcgtggactgatcctgtg
ttcttctatgtccaggccaaaacaacgtatgaaaacttcatccatctgatcattgctctg
cccattgccgttctgctgatagtaggagggttggttataatgctgtacgtcttccataga
aaaagaaataacagcaggctggggaacggagtgctgtatgcctctgtgaacccggagtac
ttcagtgcagccgatgtgtacgtgcctgacgagtgggaggtcgcccgggagaagatcacc
atgagccgggagctgggacagggctcgttcgggatggtttacgaaggtgtcgccaagggc
gtggtcaaggatgagcctgagaccagggtggccattaagacggtgaacgaggccgccagc
atgcgcgagaggattgagtttctcaacgaggcctcggtgatgaaggagttcaactgtcac
cacgtggtgcgcttgctgggcgtggtatcccagggccagccgacgctggtcatcatggaa
ctgatgacccggggggacctcaaaagttatctccggtctctgaggccagaaatggagaat
aatccagtcctagcacctcccagcctaagcaaaatgatccagatggctggagagattgca
gatggcatggcatacctcaacgccaataagtttgtccacagagacctcgctgcccggaac
tgcatggtggccgaagatttcacagtcaaaatcggagattttgggatgacgagagacatc
tatgagaccgactattaccggaagggagggaaggggctgctgcccgtgcgctggatgtcc
cccgagtccctcaaggatggagtcttcaccacgcactctgacgtctggtccttcggggtc
gtcctctgggagatcgccacgctggccgagcagccataccagggcctgtccaatgagcaa
gtccttcgctttgtcatggagggcggccttctggacaagccggacaactgtcctgacatg
ctgtttgaactgatgcgcatgtgctggcagtacaaccccaagatgaggccttccttcctg
gaaatcatcagcagcatcaaggacgagatggagcccggcttccgggaggtctccttctac
tacagcgaggagaacaagccacctgagccagaggagctggacctagagccggagaacatg
gagagtgtccccttggacccctcggcatcctcgtcctccctgccactgcccgacagacac
tcaggacacaaggccgagaacggtccgggccctggcgtgctggtccttcgagccagcttc
gacgagagacagccttatgcgcacatgaacgggggccgcaagaaggagcgggccttgcct
ctgccccagtcctcgacctgctga

DBGET integrated database retrieval system