KEGG   Orcinus orca (killer whale): 101282229Help
Entry
101282229         CDS       T05247                                 

Gene name
UBR4
Definition
(RefSeq) E3 ubiquitin-protein ligase UBR4
  KO
K10691  E3 ubiquitin-protein ligase UBR4 [EC:2.3.2.27]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor05165  Human papillomavirus infection
oor05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101282229 (UBR4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101282229 (UBR4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:oor04121]
    101282229 (UBR4)
Enzymes [BR:oor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101282229 (UBR4)
Ubiquitin system [BR:oor04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   UBR box proteins
    101282229 (UBR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E3_UbLigase_R4 zf-UBR Ribosomal_L30 DUF4820
Motif
Other DBs
NCBI-GeneID: 101282229
NCBI-ProteinID: XP_004272516
LinkDB All DBs
Position
Unknown
AA seq 5181 aa AA seqDB search
MATSGGEEAAAAAPTPGAPATEADTTPGWEVAVRPLLSASYSAFEMKELPQLVASVIESE
SEILHHEKQYEPFYSSFVALSTHYITTVCSLIPRNQLQSVAAACKVLIEFSLLRLENPDE
ACAVSQKHLILLIKGLCTGCSRLDRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELAAPV
SPELKQKEVQMNFLNQLTSVFNPRTVASSPVGPQTPAEGENDEQSSTDQASAIKTKNVFI
AQNVASLQELGGSEKLLRVCLNLPYFLRYINRFQDAVLANSFFIMPATVADATAVRNGFH
SLVIDVTMALDTLSLPVLEPLNPSRLQDVTVLSLSCLYAGVSVATCMAILHVGSAQQVRT
GSTSSKEDDYESDAATIVQKCLEIYDMIGQAISSSRRAGGEHYQNFQLLGAWCLLNSLFL
ILNLSPTALADKGKEKDPLAALRVRDILSRTKEGVGSPKLGPGKGHQGFGVLSVILANHA
VKLLTSLFQDLQVEALHKGWEADGPPAVLSIMAQSTSIQRIQRLIDSVPLTNLLLTLLST
SYRKACVLQRQRKGSMSSDASASTDSNTYYEDDFSSTEEDSSQDDDSEPILGQWFEETIS
PSKEKVAPPPPPPPPPLESSPRVKSPSKQASGEKGNILASRKDPELFLGLASNILNFITS
SMLNSRNNFIRNYLSVSLSEHHMATLASIIKEVDKDGLKGASDEEFAAALYHFNHSLVTS
DLQSPNLQNTLLQQLGVAPFSEGPWPLYIHPQSLSVLSRLLLIWQHKAGAQGDPDVPECL
KVWDRFLSTMKQNALQGVVPGETEDLNVEHLQLLLLIFHNFSEKGRRDILTLFVQIIQEL
SANMDAQTRSVPLILARLLLIFDYLLHQYSKAPVYLFEQVQHNLLSPPFGWVNGSQDSNS
RRATTPLYHGFKEVEENWSKHFSSDAVPQPRFYCVLSPEASEDDLNRLDSVACDVLYSKL
VKYDELYIALTSLLAAGSQLDTVRRKENKNVTALEACALQYYFLILWRILGILPPSKTYM
NQLAVNSPEMSECDILHTLRWSSRLRISSYVNWIKDHLIKQGMKAEHAGSLLELASSKCS
SVKYDVEIVEEYFARQISSFCSIDCTTILQLHEVPSLQSIYTLDAAISKVQVSLDEHFSK
MAAETDPHKSSEITKNLLPATLQLIDTYASFTRAYLLQNFNEEGSTEKPSQEKLHGFAAV
LAIGSSRCKANTLGPTLVQNLPSSVQAVCESWNNINTNEFPNIGSWRNAFANDTIPSESY
ISAVQAAHLGTLCGQSLPLAASLKHTLLSLVRLTGDLIVWSDEMNPPQVIRTLLPLLLES
STESVAEISSNSLERILGPAESDEFLARVYEKLITGCYNILANHADPNSGLDESILEECL
QYLEKQLESSQARKAMEEFFSDSGELVQVMMATANENLSAKFCNRVLKFFTKLFQLTEKS
PNPSLLHLCGSLAQLACVEPVRLQAWLTRMTASPPKDSDQLDVIQENRQLLQLLTTYIVR
ENSQVGEGVCAVLLGTLIPMATEMLANGDGTGFPELMVVMATLASAGQGAGHLQLHNAAV
DWLSRCKKYLSQKNVVEKLNANVMHGKHVVVLECTCHVMSYLADVTNALSQSNGQGPSHL
SVDGEERAIEVDSDWVEELAVEEEDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHCHT
CKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSSTMK
ESAFQSEPRVSESLVRHTSTSPADKAKVTISDGKVADEEKPKKSSLCRTVEGCREELQNQ
ANFSFAPLVLDMLNFLMDAIQTNFQQASAVGSSSRAQQALRELHTVDKVVEMTDQLMVPT
LGSQEGAFENVRMNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHGRRQHLAVSHEKGKIT
VLQLSALLKQADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTFSS
SGSVSDHLVLHPQLATGNFIIKAVWLPGSQTELAIVTADFVKIYDLSVDALSPTFYFLLP
SSKIRDVTFLFNEEGKNIIVIMSSAGYIYTQLMEEASSAQQGPFYVTNVLEINHEDLKDS
NSQVAGGGVSVYYSHVLQMLFFSYCQGRSFAATISRTTLEVLQLFSISIKSSNGGSKTSP
ALCQWSEVMNHPGLVCCVQQTTGVPLVVMVKPDTFLIQEIKTLPAKAKIQDMVAIRHTAC
NEQQRTTMILLCEDGSLRIYMANVENTSYWLQPSLQPSSVISIMKPVRKRKTATITTRTS
SQVTFPIDFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEISN
NNSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLNLSRSRWFDFPFTREEALQADKKLN
LFIGASVDPAGVTMIDAVKVYGKTKEQFGWPDEPPEEFPSASVSNICPSNLSQSNGTGDS
DSAAPTTTSGTVLERLVVSSLEALESCFAVGPIIEKERNKNAAQELATLLLSLPAPASVQ
QQSKSLLASLHTSRSAYHSHKDQALLSKAVQCLNTSSKEGKDLDPEVFQRLVITARSIAI
MRPNNLVHFTESKLPQMETEGADEGREPQKQLEGDCCSFITQLVNHFWKLHASKPKNAFL
APACLPGLTHIEATVNALVDIIHGYCTCELDCINTASKIYMQMLLCPDPAVSFSCKQALI
RVLRPRNKRRHVTLPSSPRSNTPMGDKDDDDDDDADEKMQSSGIPNGGHIRQESQEQSEV
DHGDFEMVSESMVLETAENVNNGNPSPLEALLAGAEGFPPMLDIPPDADDETMVELAIAL
SLQQDQQGSSSSALGLQSLGLSGQAPSSSSLDAGTLSDTTASAPASDDEGSTAATDGSTL
RTSPADHGGSVGSESGGSAVDSVAGEHSVSGRSSAYGDATAEGHPAGPGSVSSSTGAIST
TTGHQEGDGSEGEGEGEGEGDVHASNRLHMVRLMLLERLLQTLPQLRSVGGVRAIPYMQV
ILMLTTDLDGEDEKDKGALDNLLSQLIAELGMDKKDVSKKNERSALNEVHLVVMRLLSVF
MSRTKSGSKSSICESSSLISSATAAALLSSGAVDYCLHVLKSLLEYWKSQQNDEEPVATS
QLLKPHTTSSPPDMSPFFLRQYVKGHAADVFEAYTQLLTEMVLRLPYQIKKIADTNSRIP
PPVFDHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRGIKK
LLEEQGIFLRASVVTASSGSALQYDTLISLMEHLKACAEIAAQRTINWQKFCIKDDSVLY
FLLQVSFLVDEGVSPVLLQLLSCALCGSKVLAALAASAGPSSASSSSAPVATGSGQATTQ
SKSSTKKSKKEEKEKEKEGESSGSQEDQLCTALVNQLNKFADKETLVQFLRCFLLESNSS
SVRWQAHCLTLHIYRNSSKSQQELLLDLMWSIWPELPAYGRKAAQFVDLLGYFSLKTPQT
EKKLKEYSQKAVEILRTQNHILTNHPNSNIYNTLSGLVEFDGYYLESDPCLVCNNPEVPF
CYIKLSSIKVDTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTVQAI
VELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYENYQASTETLQCPR
CSASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCCA
VDPIENEEDRKKAVSNINTLLDKADRVYHQLMGHRPQLENLLCKVNEAAPEKPQDDSGTA
GGISSTSASVNRYILQLAQEYCGDCKNSFDELSKIIQKVFASRKELLEYDLQQREAATKS
SRTSVQPTFTASQYRALSVLGCGHTSSTKCYGCASAVTEHCITLLRALATNPALRHILVS
QGLIRELFDYNLRRGSAAMREEVRQLMCLLTRDNPEATQQMNDLIIGKVSTALKGHWANP
DLASSLQYEMLLLTDSISKEDSCWELRLRCALSLFLMAVNIKTPVVVENITLMCLRILQK
LIKPPAPTSKKNKDVPVEALTTVKPYCNEIHAQAQLWLKRDPKASYEAWKKCLPIRGIDG
NGKSPSKSELHHLYLTEKYVWRWKQFLSRRGKRTSPLDLKLGHNNWLRQVLFTPATQAAR
QAACTIVEALATIPSRKQQVLDLLTSYLDELSVAGECAAEYLALYQKLITSAHWKVYLAA
RGVLPYVGNLITKEIARLLALEEATLSTDLQQGYALKSLTGLLSSFVEVESIKRHFKSRL
VGTVLNGYLCLRKLVVQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNL
DDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPL
MRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKKVWCTTNEGEPMRIVY
RMRGLLGDATEEFIESLDSTTDEEEDEEEVYKMAGVMAQCEGLECMLNRLAGIKDFKQGR
HLLTVLLKLFSYCVKVKVNRQQLVKLEMNTLNVMLGTLNLALVAEQESKDSGGAAVAEQV
LSIMEIILDESNAEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLLRIIPY
LSFGEVEKMQILVERFKPYCSFDKYDEDHSGDDKVFLDCFCKIAAGIKNNSNGHQLKDLI
LQKGITQNALDYMKKHIPSAKNLDADIWKKFLSRPALPFILRLLRGLAIQHPATQVLIGT
DSITNLHKLEQVSSDEGIGTLAENLLEALREHPDVNKKIDAARRETRAEKKRMAMAMRQK
ALGTLGMTTNEKGQVVTKTALLKQMEELIEEPGLTCCICREGYKFQPTKVLGIYTFTKRV
ALEEMENKPRKQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLPV
WGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDTKLLFLRFAMEQSFSADTGGGG
RESNIHLIPYIIHTVLYVLNTTRATSREEKNLQGFLEQPKEKWVESAFEVDGPHYFTVLA
LHVLPPEKWRAIRVEILRRLLVTSQARAVAPGGASRLTDKAVKDYSAYRSSLLFWALVDL
IYNMFKKVPTSNTEGGWSCSLAEYIRHNDMPIHEAADKALKAFQEEFMPVETFSEFLDAA
GLLSEITDPESFLKDLLDSVP
NT seq 15546 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgagcggcggcgaagaggcggcggctgcggcgccgacgcccggggccccggca
acggaggcagacacgaccccgggctgggaggtggcggtgcggcccctgctatccgcgtcc
tattccgccttcgagatgaaggagttgccgcagctggtggcctcagtcatcgagagtgaa
tcagaaatcctgcaccacgagaagcagtatgagccattctactcatcttttgttgcactt
tccacacactatatcacaacagtttgtagcctcattccccggaaccaacttcagtctgtg
gcagcagcctgtaaagtcctgattgagttttctctcctgcgtctggagaatccagatgag
gcttgcgctgtgtcccagaaacacttgattctcctcatcaagggcctgtgcactggctgt
agccgattagacagaactgaaatcatcacatttacagcaatgatgaaatcggccaagctg
ccacaaacagtgaagacactgtcagatgtggaagatcagaaagagctggctgcaccagta
agcccagagctgaagcagaaggaggtccagatgaattttttgaaccagctgacgtcagtt
tttaaccctagaactgtagcatcatcacccgtaggtccacagactccggcggaaggagaa
aatgatgagcagtcatccacagatcaagcctctgctatcaaaaccaagaatgtgttcata
gctcagaatgtggctagtcttcaggagcttggtggctcagagaagctactgcgtgtgtgt
ttaaacctgccctatttcctacgctacatcaatcggtttcaagatgcagtgttggccaat
tccttcttcatcatgcctgcaacagtagcagatgccactgctgttcgtaatggttttcat
tcactggtgattgatgtaaccatggcattggataccctttctctacctgtgttggaacct
ctcaatccttctcgtctgcaagatgtgacagtcctcagcctaagttgtttgtatgcaggt
gtgagtgtggcaacttgcatggccatccttcacgtgggtagtgcccagcaagtgcggaca
gggtccacgagctccaaagaagacgactatgagagtgatgcagctacaattgtccaaaaa
tgtcttgaaatctatgacatgattggacaagcgatcagcagttcccgccgggctggtggt
gagcactatcagaacttccaattgctgggtgcctggtgtttgttaaacagccttttcctc
atattgaacctcagtcctactgccttggctgataaggggaaagagaaagatccgctggct
gctctccgggtcagagacatcctttctcgtacaaaggagggagtgggctctccaaagctg
gggcctggaaaagggcatcagggatttggggtgctctcagtaatattggcaaaccatgcc
gtcaagctgttgacgtctctctttcaagacctgcaagtggaggctctgcacaagggttgg
gaggcagatggtccccctgctgtcctgagcattatggcccagagtacctccatacagagg
attcaacggctgatagactctgtcccactgacaaacctactgttgacattactctcaact
tcctacagaaaggcatgtgtcctgcagcgtcagaggaagggctctatgagcagcgatgcc
agcgcctctactgactcaaacacctactacgaggatgatttcagcagcacggaggaggac
agcagccaagatgatgacagtgagcctattctggggcagtggtttgaagagaccatctcc
cccagtaaagagaaagtggcacctccgcctcctcccccaccccctccgctggagagctca
cctcgagttaaaagccccagtaagcaggcctctggtgagaagggcaacattttggctagt
cgcaaagatcctgagttgttcttaggtctggcttccaacattttgaacttcatcacctct
tccatgctgaactctcggaataattttatccgaaactatctgagtgtatctctttcagaa
caccatatggccaccctggccagtatcattaaggaggtggacaaagatggactcaagggc
gcatcagatgaagagtttgctgccgctctctatcacttcaaccactctctggtaacttct
gaccttcagtcacctaacctgcagaatacactgttgcagcagctgggagtggctcctttt
tctgagggcccttggcccttgtacattcatcctcaaagcctgtctgtgctttcacgcctc
ctgctcatctggcaacataaagccggtgctcaaggtgaccctgacgtccctgaatgcctt
aaagtttgggacaggtttttgtcaacaatgaagcagaatgccctgcaaggggtggtgccc
ggtgagacggaagatttgaatgtagaacacctgcagctgctcctcctcattttccacaac
ttctctgagaaaggccggcgggacatattgaccctttttgtgcagatcatccaggagttg
agtgccaacatggatgcccagacgcgctctgtgcctctcatcctggctcgcctgcttttg
atctttgattatctgcttcatcagtactctaaagcccctgtgtatctgtttgagcaggtg
caacataacctgcttagtccgccttttgggtgggtgaatggatcccaggacagcaacagc
cgccgggcgaccactcctctctatcatgggttcaaagaagtagaagaaaactggtctaag
catttttcatcagatgctgtcccgcaacccagattctactgtgtcctgtccccagaagcc
tcagaggatgatttgaaccgacttgattctgtggcatgtgatgttctttactccaagctt
gtcaagtatgatgagctctacattgcattgacatccctgctggcggctggatcccagctt
gatacagtcaggagaaaggaaaacaagaatgtaacagccctggaggcctgtgcccttcaa
tattacttcctgatactctggaggattctagggattttgccaccatcaaagacttacatg
aaccagctggccgtgaactcaccagagatgagtgaatgtgacatcctacacactctgcgg
tggtcttcccgcctccggatcagctcctatgtcaactggataaaggaccaccttatcaaa
cagggaatgaaggctgaacatgctggttctctcctagaactggcatcaagcaagtgcagc
tcagtgaaatacgacgttgaaattgtagaggaatactttgctcgacagatctcgtccttc
tgtagcatcgactgtaccaccatcttgcagctccatgaagttcccagtctgcagtccatc
tacaccctcgatgctgctatctcgaaggtccaggtctctctggatgaacatttttctaag
atggctgccgagaccgatcctcataagtcatctgagatcaccaagaacctgcttccagcc
acactgcagctcattgacacctacgcatcattcactagagcctatttgctgcaaaacttt
aatgaggagggatccactgaaaaaccttcccaggagaaattgcacggctttgctgctgtt
ttggctattggctctagtaggtgcaaggcgaacactctgggtccaacactggttcagaat
ttaccatcttcggtgcaggctgtgtgtgaatcctggaacaacatcaacaccaatgagttt
ccaaacattggatcctggcgcaatgcctttgccaatgacaccatcccttctgagagttac
atcagtgctgtgcaggccgctcacctggggactctttgtggccagagtctgcccctggct
gcttcgctgaagcacaccctcctctcactggtcaggttgactggagatcttatagtttgg
tccgatgagatgaacccgccacaggtaattcggaccctgcttccccttcttctggagtcg
agcactgagagtgtcgctgagatcagtagcaactctctggagcgcatcttgggccctgca
gagtctgatgagttcttggctcgcgtttatgagaaactaatcactggctgttacaacatt
ctggctaatcatgcagatcccaatagtggactggatgaatccatcttagaagaatgtctc
cagtatttggaaaagcaactggaaagcagtcaggctcgtaaagctatggaggaatttttc
tctgacagtggagaacttgtgcaggtcatgatggcaacagccaatgagaacctctctgct
aaattctgtaaccgagttttgaaattcttcaccaaactcttccagctgactgagaagagc
cctaacccgagccttctgcatctctgtggttccctggcacagctggcttgcgtggagcct
gtgcgtctccaggcctggctcacccgcatgactgcatcgccccccaaagattccgatcag
ctggatgtgatccaggagaacaggcagctgctacagttgttgaccacgtacattgttcgg
gaaaacagccaagtcggggaaggtgtgtgtgctgtgctgttgggcaccctgatccccatg
gcaacagagatgctggccaatggtgatgggactggtttccctgaactcatggttgtgatg
gctaccctggccagtgcaggtcaaggtgctggccatcttcagcttcataatgctgctgtg
gactggctgagtagatgcaagaaatacctgtcacagaagaatgtggtcgaaaaactgaat
gccaatgtaatgcatggaaagcatgtggtagtcctggagtgtacctgccatgttatgtct
tacttggctgatgtcaccaatgccttgagccagagtaacggtcaaggcccaagtcacctc
tcagtggatggggaagagcgggccattgaagtggactcagactgggtggaggagctggca
gtggaagaggaagactcccaggctgaggattcagatgaagattctctttgcaataaattg
tgcacttttaccatcactcagaaagaattcatgaaccagcattggtaccactgtcacacc
tgcaaaatggttgatggggtgggtgtgtgtacagtatgtgccaaggtgtgccacaaggat
catgagatttcctatgccaagtatggatccttcttctgtgactgtggagccaaggaagat
ggcagctgtctggctctagtgaagcgaactcccagcagcggcatgagctccaccatgaag
gagtcagcatttcagagtgaacccagagtttcagagagtctcgtgcgccacaccagcacc
tccccggctgacaaggccaaagtcaccatcagtgacggaaaggttgctgatgaagagaag
cccaagaagagcagcctgtgccgcacagtggagggctgccgggaggagctgcagaaccag
gccaatttctccttcgctcctctcgtgttagacatgctcaatttcctcatggatgccatt
cagaccaactttcagcaggcttcagctgtggggagcagcagccgggctcagcaggccctc
cgggagctgcacacagtggacaaggtggttgagatgacagaccagctgatggttcccaca
ttaggttcccaggaaggtgcctttgagaatgttcggatgaattacagtggagaccagggc
cagacaattcgacagctaatcagcgcccatgtgctcaggagggtggctatgtgtgtgctc
tcctcccctcatgggcgccgccagcatttggctgtcagccatgagaaaggcaagatcact
gtcctgcagctctcagccctcctgaagcaagcagattccagcaaaaggaagctgactctg
acccgcctggcttctgccccagtcccctttactgtgctgagcctcacggggaatccgtgc
aaggaggactaccttgctgtttgtgggctgaaggactgccacgtgctgaccttcagtagc
tcaggctctgtgtcggatcatttggttttgcacccccagttggcaacagggaacttcatc
atcaaagccgtgtggttacctggttcacagactgagctagcgatcgtcactgcagatttt
gtcaagatttatgacctgtccgttgatgccttgagtccaaccttctactttctcctgccc
agctcaaagataagagatgttaccttcctcttcaacgaagagggaaagaacatcattgtt
ataatgtcttcggctgggtacatctatacccagctcatggaagaggccagcagtgcccag
cagggacccttctatgtcactaatgtgctggaaataaaccacgaggacctgaaggacagt
aacagccaggtggcaggtggcggtgtgtctgtctactactcgcacgtgttgcagatgctg
ttcttcagctactgtcagggcaggtcgttcgcagccaccatcagtaggacgacgctggag
gtgttgcagctcttctccatcagcatcaagagttccaatggtggcagcaagacgtctcct
gccctttgccagtggtctgaggtgatgaaccaccctggcttggtgtgttgtgtccagcaa
actacaggagtgcccctggtagttatggtgaaaccagacactttcctcatccaggagatt
aagactcttcctgccaaagcaaagatccaggacatggtcgccatcaggcacacagcctgc
aatgagcagcagcggacaacgatgatcttgctgtgtgaggatggcagcctgcgcatctac
atggccaacgtggagaacacctcctactggcttcagccctccctgcagcccagcagtgtc
atcagcataatgaagcctgttcgaaagcgcaaaacagctaccatcacaactcgcacatct
agccaagtgaccttccccattgacttctttgaacacaaccagcagctgacagatgtggaa
tttggtggtaatgacctcctgcaggtctacaacgcacaacagataaagcaccggctgaat
tccactggcatgtatgtggccaacaccaagcctggtggcttcaccattgagatcagtaac
aacaacagcactatggtgatgacaggcatgcggatccagattgggacccaggcaattgaa
cgggccccatcatatattgagatctttggcagaaccatgcagcttaacctgagtcgctca
cgctggtttgacttcccgttcaccagagaagaagccctgcaggccgataagaagctgaac
ctcttcattggggcctccgtggatccagcaggtgtcaccatgatcgatgctgtaaaagtc
tatggcaagactaaggagcagtttggctggcctgatgagcccccggaagaattcccttct
gcctccgtcagcaacatctgtccttcaaacctgagccagagcaatggcactggagacagt
gattcagctgcccctaccaccacgagtggaactgtcctggagaggctggttgtcagttct
ttagaagccctggaaagctgctttgctgttggcccaatcatcgagaaggagagaaacaag
aatgcagctcaggagctggccactctgctgctgtccctgccagcgcctgccagtgtccag
cagcagtccaagagccttctggccagcctgcacaccagccgctcagcctatcacagccac
aaggatcaggccttgctgagcaaagctgtgcagtgtctcaacacatccagcaaagaaggc
aaggatttggaccctgaggtcttccagaggctggtgatcacagctcgctccattgccatc
atgcgtcctaataaccttgtccactttacggagtcaaagctgccccagatggaaacagaa
ggagcggatgaggggagagaacctcagaagcagttggagggagactgctgtagtttcatc
acccagctggtgaaccacttctggaaactccatgcatccaaacccaagaatgccttcttg
gcacctgcctgcctgccaggcctaactcatattgaagctaccgttaatgctctggtagac
attatccatggctactgtacctgtgagctggactgtattaatacagcatccaagatatac
atgcagatgctactgtgtcctgatcctgctgtgagcttctcttgtaaacaagctctaatt
cgagtcctaaggccgaggaacaagcggagacatgtgacgttgccctcctcccctcgaagc
aacactccaatgggagacaaggatgatgatgacgatgatgatgcagatgagaaaatgcag
tcgtcagggatcccgaatggtggtcacatccgtcaggaaagccaggaacagagtgaggtg
gaccatggagattttgagatggtgtctgagtcgatggtcctggagacagctgaaaatgtc
aacaatggcaacccctctcccctggaggccctgctggcaggcgcagagggcttccccccc
atgctggacatcccgcctgatgcagatgacgagaccatggttgaactagccattgccctg
agcctgcagcaggaccagcaaggcagcagcagcagtgccctgggcctgcagagcctgggg
ctgtccggccaggcacccagctcttcctctctggacgcaggaaccctctctgacaccaca
gcatcagctccagcctcagacgacgagggcagcacagcagcaactgatggttccaccctt
cggacctcccctgctgaccacggtggtagtgtgggctcggagagcgggggaagtgcagtg
gactcggtggctggcgagcacagtgtatctggccggagcagtgcttatggtgatgccaca
gcagaggggcatccggctggaccaggaagtgtcagttcaagcactggcgccatcagcacc
accaccggacatcaggaaggagatggctccgagggagaaggagaaggggaaggggaagga
gatgtccacgctagcaacaggctgcacatggtccgtctgatgctgttggagagactactg
caaactttgccccagttacgaagtgttggaggtgtccgggccattccatacatgcaggtc
attctgatgcttactacagatctggatggagaagatgagaaagacaagggggccctggac
aacctgctctcccagcttattgctgaactgggcatggataagaaggacgtctccaagaag
aacgaacgcagtgccctgaatgaggtccacctggtggtgatgagactcctgagtgtcttc
atgtccaggaccaaatccggatccaagtcttccatatgcgagtcatcttccctcatctcc
agtgccacagcagcagccctgctgagctctggcgctgtggactactgcctgcacgtgctc
aagtccctgctggagtactggaagagccagcagaacgatgaggaacccgtggctaccagc
cagctgctgaaaccacatactacgtcatccccacccgacatgagcccattcttcctccgc
cagtatgtgaagggccatgctgctgatgtgtttgaggcctacactcagcttctcacagag
atggtactgaggctgccataccagatcaaaaagatcgctgacaccaattctcgaatccca
cctcctgtctttgatcattcgtggttttactttctctcagagtacctgatgatccagcaa
actccatttgtgcgccggcaagtccgcaaacttctgctcttcatctgtgggtcaaaggag
aaataccgccagctccgggatttgcacaccctcgactcccatgtgcgcgggatcaagaag
ctgctggaggagcaggggatcttcctccgggcaagtgtggttacagccagctctggctcc
gccctgcagtatgacacgctcatcagcctgatggagcacctgaaagcctgtgcagagatt
gctgcccagcgaaccatcaactggcagaaattctgcatcaaagatgactctgtcctgtac
ttcctcctccaagtcagcttcttggtggatgagggcgtgtctccggtgctgctgcagctg
ctctcctgtgctctgtgcggcagcaaagtcctcgctgcactggcggcctcggcagggccc
tccagtgcttcctcctcctcagcccctgtggccactggttctggacaagccacaacacag
tcaaagtcgtccacaaagaagagtaagaaagaagaaaaggaaaaggagaaagagggtgag
agctcaggaagccaggaggatcagctgtgcacagctctggtgaaccagctgaacaaattt
gcagataaggagaccttggtccagtttctgcgttgcttcctcttagagtccaattcttcc
tcggtgcgctggcaggcccactgcctgacgctgcatatctacagaaactctagcaaatct
caacaggagctcctgctagatctgatgtggtctatatggccagaactcccagcctacggt
cgtaaggctgcccaatttgtggacctactaggatatttctccttgaaaaccccacaaaca
gagaagaagttgaaagaatattcacagaaggctgtggagattcttcgtactcagaaccac
attcttaccaaccatcccaactccaacatttacaacaccttgtctggcctagtggagttt
gatggctattacctggagagtgatccctgccttgtgtgtaataatccagaagtgccgttt
tgttatatcaagctgtcttccattaaagtggacacaaggtacaccaccacccagcaggtt
gtgaagctcattggcagccacaccatcagcaaagtgacggtgaaaattggggacctgaaa
cggaccaagatggtgcggactatcaacctctattacaacaaccgaactgtgcaggccatc
gtggagctgaaaaacaagccggctcgctggcacaaagccaagaaggttcagctgaccccc
gggcagacagaggtgaagatcgacctgcctttgccaatagtggcttccaacctgatgatt
gagtttgcagacttctatgaaaactatcaggcctccacggagaccctgcagtgcccacgc
tgtagtgcctcagtccctgccaacccaggggtctgtggcaactgtggagagaatgtctac
cagtgtcacaaatgcagatccatcaactatgatgaaaaggaccccttcctgtgcaatgcc
tgtggcttctgtaaatacgctcgcttcgacttcatgctctatgccaagccttgctgtgca
gtggatcccattgagaatgaagaagaccggaagaaggctgtttccaacatcaacacactt
ctggacaaagctgatcgagtgtatcaccagctgatgggacatcggccacagctggagaac
ctgctctgcaaagtgaacgaggcagctcctgaaaagccgcaggatgactcggggacggct
gggggcatcagttccacctcagccagtgtgaaccggtacatcctacagttggcacaggag
tactgtggagactgcaagaactctttcgatgaactctccaaaatcatccagaaagttttt
gcttcacgcaaagagttgctggaatacgaccttcagcagagggaagcagccaccaaatca
tctcggacctccgtgcagcccaccttcactgccagccagtaccgcgccttgtccgtcctg
ggctgtggccacacatcctccaccaagtgctacggctgcgcctcggccgtcacagagcac
tgtatcaccctgctccgggccctggccaccaaccccgccctgaggcacatcctcgtctcc
cagggcctcatcagggagctctttgattataatcttcgcagaggctctgcggccatgcgg
gaggaggtccgccagctcatgtgcctcctgacccgggacaatccagaggccacccagcaa
atgaacgacctgattattggcaaagtctccacagccctgaagggccactgggccaatcct
gatctggcaagtagccttcagtatgaaatgctgttgctgacagactctatctcgaaggag
gacagctgctgggagctccgcttacgctgtgcactcagccttttcctcatggccgtgaac
attaagactcccgtggttgttgagaacattaccctcatgtgcctgcggatcttgcagaag
ctgattaaaccacctgctcccaccagcaagaagaacaaggatgttcctgtcgaggccctt
accacagttaagccatactgcaatgagatccatgcccaggctcagctctggctcaagaga
gaccccaaggcatcctatgaagcctggaagaagtgtcttcctatcagagggatcgatggc
aacgggaagtcccccagcaaatcagagctccaccatctctatttgactgagaagtacgtg
tggcggtggaagcagttcctgagtcgtcgggggaagaggacctcccccttggatctcaag
ctgggccacaacaactggctgcggcaagtgctttttactcccgcgacgcaggctgcacgg
caggcagcctgtaccatagtggaagctctggccaccattcccagccgcaagcagcaggtc
ctcgacctcctcaccagttacctggacgagttgagcgtagccggggagtgtgccgccgag
tacctggcgctctaccagaagctcatcacttcagctcactggaaagtctacctggcagct
cgaggagtcctgccctacgtgggcaacctcatcaccaaggaaatagcccgcttgttggcc
ctggaggaggccaccctgagcactgatctgcagcagggctatgccctcaagagtctcaca
ggccttctttcctccttcgtggaggtggaatccatcaaaaggcactttaaaagtcgcttg
gtgggtactgtgctgaatggatacctgtgcttgcggaagctggtggtgcagaggaccaag
ctgattgacgagacccaggacatgctgctggagatgctggaggacatgaccacaggtaca
gaatcggaaaccaaggctttcatggccgtgtgcattgagacagccaagcgctacaatctg
gatgactaccggactcctgtcttcatctttgagaggctctgcagcatcatctatcctgag
gagaatgaagtcactgagttctttgtgaccctggagaaggatccccaacaagaagacttc
ttacagggcaggatgcctgggaacccgtacagcagcaatgagccaggcattgggccactc
atgagggatataaagaacaagatttgccaggactgtgacttggtggctctcctggaggat
gatagtggaatggagcttctagtgaacaataaaatcattagtttggaccttcctgtggcc
gaggtttacaagaaggtctggtgtaccacgaatgagggagagcccatgaggattgtttac
cggatgcgggggctgctgggcgacgccaccgaggagtttatcgagtccctggactccacc
acggacgaagaagaagatgaagaagaagtgtataagatggctggtgtgatggcccagtgc
gagggcctggaatgcatgcttaacagactggcagggatcaaagacttcaagcagggacgc
caccttctaacagtgctgctgaaattattcagttactgcgtgaaggtgaaagtcaaccgg
caacagctggtcaagctggaaatgaacactttgaatgtcatgctggggactctcaacctg
gccctggtagctgagcaagaaagcaaggacagtggtggtgcagctgtggccgagcaggtg
cttagcattatggagatcattctggatgagtccaatgctgagcccctgagtgaggacaag
ggcaacctcctcctgacgggtgacaaagatcaactcgtgatgctcttggaccagatcaac
agcacctttgttcgctccaaccccagcgtgctccagggcctgcttcgcatcatcccatac
ctgtccttcggggaggtggagaaaatgcagatcttggtggagcggttcaaaccatactgc
agctttgataagtatgacgaagatcacagtggcgatgataaagtcttcctggactgcttc
tgtaaaatcgcagctggcatcaagaacaacagcaatgggcatcagctaaaggatctgatt
ctccagaagggaatcacccagaatgcacttgactatatgaaaaagcacattcccagtgcc
aagaatttggatgcggacatctggaaaaagtttttgtctcgcccagccctgccgtttatc
ttgagacttcttcgggggttagccatccagcaccctgccacccaggttctgatcggaacc
gactccattacaaacctgcataaactggagcaggtgtccagcgatgagggcattgggacc
ctggcagagaacctgctggaggcactgcgggaacaccctgacgtaaacaagaagatagac
gcagcccgcagggagacccgggccgagaagaagcgcatggccatggccatgaggcagaag
gctctgggcacgctgggcatgacgaccaatgagaagggccaggtcgtgaccaagacggcg
ctcctgaagcagatggaggagctgatcgaggagccgggcctcacatgctgcatctgcagg
gaagggtacaagttccagcccaccaaggtcctgggcatttataccttcaccaagcgggta
gccttagaggagatggagaacaagccccggaaacagcagggctacagcaccgtgtcccac
ttcaacatcgtgcactacgattgccacctggctgccgtcaggctggctcgaggccgggaa
gagtgggaaagtgccgcccttcagaacgccaacactaagtgcaacggtctccttcccgtc
tgggggccccatgtccctgagtcagcttttgccacctgtctggcaaggcacaatacttac
ctccaggagtgcacgggccagcgggagcccacgtaccagctcaacatccacgacaccaag
ctgctgttcctgcgcttcgccatggagcagtccttcagcgcggacactggagggggcggc
cgggagagcaacatccacctgatcccgtacatcatccacaccgtgctttacgtcctgaac
acaacccgagcaacttcccgagaggagaagaacctccagggctttctggagcagcccaag
gagaagtgggtggagagtgcctttgaagtggacgggccccactacttcactgtcctggcc
ctccacgtcctgccccccgagaagtggcgagccatacgcgtggaaatcctgcggcggctg
ctggtgacctctcaggcccgggcagtggctccggggggagctagcaggctgacagacaag
gcggtgaaggactactctgcttatcgctcttcccttctcttttgggccctcgttgatctc
atttataacatgtttaagaaggtgccgaccagcaacacggagggtggctggtcctgctct
ctggcagagtacatccgccacaacgacatgcccatccacgaagctgccgacaaggccctg
aaggccttccaggaggagttcatgccagtggagaccttctcagagttcctcgacgccgct
ggtctcttatcagaaatcactgatccggagagcttcctgaaggacctgttggactcagtc
ccctga

DBGET integrated database retrieval system