KEGG   Orcinus orca (killer whale): 101283084
Entry
101283084         CDS       T05247                                 

Gene name
RPS6KB1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04012  ErbB signaling pathway
oor04066  HIF-1 signaling pathway
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04152  AMPK signaling pathway
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04350  TGF-beta signaling pathway
oor04371  Apelin signaling pathway
oor04666  Fc gamma R-mediated phagocytosis
oor04714  Thermogenesis
oor04910  Insulin signaling pathway
oor04931  Insulin resistance
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05210  Colorectal cancer
oor05212  Pancreatic cancer
oor05221  Acute myeloid leukemia
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101283084 (RPS6KB1)
   04350 TGF-beta signaling pathway
    101283084 (RPS6KB1)
   04371 Apelin signaling pathway
    101283084 (RPS6KB1)
   04066 HIF-1 signaling pathway
    101283084 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    101283084 (RPS6KB1)
   04152 AMPK signaling pathway
    101283084 (RPS6KB1)
   04150 mTOR signaling pathway
    101283084 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101283084 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101283084 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101283084 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    101283084 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    101283084 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101283084 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101283084 (RPS6KB1)
   05205 Proteoglycans in cancer
    101283084 (RPS6KB1)
   05231 Choline metabolism in cancer
    101283084 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101283084 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101283084 (RPS6KB1)
   05212 Pancreatic cancer
    101283084 (RPS6KB1)
   05225 Hepatocellular carcinoma
    101283084 (RPS6KB1)
   05226 Gastric cancer
    101283084 (RPS6KB1)
   05221 Acute myeloid leukemia
    101283084 (RPS6KB1)
   05224 Breast cancer
    101283084 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101283084 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101283084 (RPS6KB1)
   05163 Human cytomegalovirus infection
    101283084 (RPS6KB1)
   05165 Human papillomavirus infection
    101283084 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101283084 (RPS6KB1)
   01522 Endocrine resistance
    101283084 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101283084 (RPS6KB1)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101283084 (RPS6KB1)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101283084 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101283084
NCBI-ProteinID: XP_004271789
LinkDB
Position
Unknown
AA seq 525 aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQAPVEYPMETSG
IEQMDVTTSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgccggacttccgagacagggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagtcgga
ccatatgaacttggcatggagcattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgagtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaataccgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcattgtggatttaatttat
gcctttcagactggtggaaaactctacctcatccttgagtatctcagcggaggagaatta
tttatgcagttagaaagagaaggaatatttatggaagacacagcctgcttttacttggca
gaaatctccatggctttggggcatttacatcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagattttggactatgc
aaagaatctattcatgatggaacagtcacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtctggga
gcattaatgtatgacatgctgactggagcacccccgttcactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggtcct
ggggacgctggagaagttcaagctcatccgttcttcagacatattaactgggaagaactg
ctggctcggaaggtagagcccccctttaaacctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacacgtcagacacctgttgacagcccagatgactcaactctc
agtgaaagtgccaaccaggtctttctgggttttacctatgtggctccatctgtacttgaa
agcgtgaaagaaaagttttcctttgaaccaaaaatccggtcacctcgaagatttattggc
agcccacgaacacctgtcagccctgtcaaattttctcctggggatttctggggaagaggt
gcttcagccagcacggcaaatcctcaggcgcctgtggagtacccaatggaaacaagtgga
atagagcagatggatgtgacgacgagtggggaagcttcagcaccacttccaatacgacag
ccgaactccgggccatacaaaaaacaagcttttcccatgatctccaaacgaccagaacac
ctgcgtatgaatctatga

KEGG   Orcinus orca (killer whale): 101286642
Entry
101286642         CDS       T05247                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04012  ErbB signaling pathway
oor04066  HIF-1 signaling pathway
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04152  AMPK signaling pathway
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04350  TGF-beta signaling pathway
oor04371  Apelin signaling pathway
oor04666  Fc gamma R-mediated phagocytosis
oor04714  Thermogenesis
oor04910  Insulin signaling pathway
oor04931  Insulin resistance
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05210  Colorectal cancer
oor05212  Pancreatic cancer
oor05221  Acute myeloid leukemia
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101286642 (RPS6KB2)
   04350 TGF-beta signaling pathway
    101286642 (RPS6KB2)
   04371 Apelin signaling pathway
    101286642 (RPS6KB2)
   04066 HIF-1 signaling pathway
    101286642 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    101286642 (RPS6KB2)
   04152 AMPK signaling pathway
    101286642 (RPS6KB2)
   04150 mTOR signaling pathway
    101286642 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101286642 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101286642 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101286642 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    101286642 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    101286642 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101286642 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101286642 (RPS6KB2)
   05205 Proteoglycans in cancer
    101286642 (RPS6KB2)
   05231 Choline metabolism in cancer
    101286642 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101286642 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101286642 (RPS6KB2)
   05212 Pancreatic cancer
    101286642 (RPS6KB2)
   05225 Hepatocellular carcinoma
    101286642 (RPS6KB2)
   05226 Gastric cancer
    101286642 (RPS6KB2)
   05221 Acute myeloid leukemia
    101286642 (RPS6KB2)
   05224 Breast cancer
    101286642 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101286642 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101286642 (RPS6KB2)
   05163 Human cytomegalovirus infection
    101286642 (RPS6KB2)
   05165 Human papillomavirus infection
    101286642 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101286642 (RPS6KB2)
   01522 Endocrine resistance
    101286642 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101286642 (RPS6KB2)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101286642 (RPS6KB2)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101286642 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 101286642
NCBI-ProteinID: XP_004278060
LinkDB
Position
Unknown
AA seq 486 aa
MAAVFDLDLETEEGSEGEGEPEFSPADVCPLAELRAAGLEPVGHYEEVELTESSVNPGPE
RIGPHCFELLRVLGKGNYGKVFQVRKVQGTNVGRIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLSEITL
ALGHLHSQGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLELPAYLTPDARDLV
KKFLKRNPSQRIGGGPGDAADVQRHPFFRHVNWDDLLARRVDPPFRPSLQSEEDVSQFDS
HFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSLQPKLRSPRRLNGSPWT
PISPLKFSPFEGFRPSPGPPEPLEPTLPPLLLPLPPLPPPSSTAPLPIRPPSGTKKSKKG
RGRPGR
NT seq 1461 nt   +upstreamnt  +downstreamnt
atggcggcggtgtttgacctggacctggagacggaggaaggcagcgagggcgagggcgag
ccagagttcagccccgcggacgtgtgtccccttgccgagttgagggcggctggcctggag
cctgtggggcactatgaagaggtggagctgactgagagcagtgtgaacccgggccctgag
cgcatcgggccccactgcttcgagctgctgcgcgtgctgggcaaggggaactatggcaag
gtgttccaggtgcgaaaggtgcagggcaccaatgtgggcagaatatatgccatgaaagtc
ctgaggaaggccaaaattgtgcgcaacgccaaggacacggcacacacgcgggctgagcgg
aacattctagagtcagtgaagcaccccttcattgtggaactggcctatgccttccagact
ggtggcaaactctacctcatcctggagtgcctcagtggcggcgagctcttcacacatctg
gagcgagagggcatcttcctggaagacacggcctgtttctacctgtcagagatcacactg
gccctgggccatctccactcccaaggcatcatctaccgggatctcaaacctgagaacatc
atgctcaacagccagggtcacatcaaactgacggacttcggcctctgcaaggagtcgatt
cacgagggtgccgtcacccacaccttctgcggcaccatcgagtacatggcccctgagatt
ctggtgcgcagtggccacaaccgggcggtggactggtggagcttgggggccctgatgtac
gacatgctcactggatcgccacccttcactgcagagaaccggaagaaaaccatggataag
atcatcagagggaagctggagctgcccgcctacctcaccccagatgcccgggacctcgtc
aaaaagtttctgaagcggaatcccagccaacgtatcgggggtggccctggggacgccgct
gatgtgcagaggcaccccttcttccggcacgttaattgggatgacctcctggcccgccga
gtggacccccctttccggccgtccctgcagtcggaggaggacgtgagccagtttgactcc
cacttcacgaggcagacgccggtggacagtccagacgacacggccctcagtgagagcgcc
aaccaggccttcctgggcttcacgtacgtggcgccctccgtcctggacagcatcaaggag
ggcttctccctccagcccaagctgcgctcccccaggcgcctcaacggcagcccctggacc
cccatcagccccctgaagttctcgccctttgagggattccggcccagccccggcccaccg
gagcccctggagcccactctaccccctctcttgctgccgctgccgccactaccgccgccc
tcgagcactgcccccctccccatccgacccccttcagggaccaagaagtccaagaaaggc
cgtgggcgccccgggcgctaa

DBGET integrated database retrieval system