KEGG   Orcinus orca (killer whale): 101283619
Entry
101283619         CDS       T05247                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 isoform X1
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor01524  Platinum drug resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04020  Calcium signaling pathway
oor04066  HIF-1 signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04510  Focal adhesion
oor04520  Adherens junction
oor04530  Tight junction
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05215  Prostate cancer
oor05219  Bladder cancer
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101283619 (ERBB2)
   04012 ErbB signaling pathway
    101283619 (ERBB2)
   04066 HIF-1 signaling pathway
    101283619 (ERBB2)
   04020 Calcium signaling pathway
    101283619 (ERBB2)
   04151 PI3K-Akt signaling pathway
    101283619 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101283619 (ERBB2)
   04520 Adherens junction
    101283619 (ERBB2)
   04530 Tight junction
    101283619 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101283619 (ERBB2)
   05206 MicroRNAs in cancer
    101283619 (ERBB2)
   05205 Proteoglycans in cancer
    101283619 (ERBB2)
   05230 Central carbon metabolism in cancer
    101283619 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101283619 (ERBB2)
   05226 Gastric cancer
    101283619 (ERBB2)
   05219 Bladder cancer
    101283619 (ERBB2)
   05215 Prostate cancer
    101283619 (ERBB2)
   05213 Endometrial cancer
    101283619 (ERBB2)
   05224 Breast cancer
    101283619 (ERBB2)
   05223 Non-small cell lung cancer
    101283619 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101283619 (ERBB2)
   01524 Platinum drug resistance
    101283619 (ERBB2)
   01522 Endocrine resistance
    101283619 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101283619 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oor04147]
    101283619 (ERBB2)
   04090 CD molecules [BR:oor04090]
    101283619 (ERBB2)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101283619 (ERBB2)
Protein kinases [BR:oor01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101283619 (ERBB2)
Exosome [BR:oor04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101283619 (ERBB2)
CD molecules [BR:oor04090]
 Proteins
  101283619 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 101283619
NCBI-ProteinID: XP_004282780
LinkDB
Position
Unknown
AA seq 1255 aa
MELAAWCRWGLLLALLPPGAAGTQVCTGTDMKLRPLASPETHLDMLRHLYQGCQVVQGNL
ELTYLPANASLSFLQEIQEVQGYVLIAQNRVSQVPLQRLRIVRGTQLFEDNYALAVLDNG
GLLEGAPPAARAAPGGLQELQLRSLTEILKGGVLIQRNPQLCHQDTIVWKDIFHRNNQLA
LMQIDTNRSRACPPCSPACKAPHCWGESSKDCQSLTRTVCASGCARCKGPQPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTTCP
YNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFVPESFEGDQASNTAPLQPEQLRVFESLEEITGYLYISAWPDSLP
DLHVFQNLRVIRGRVLHDGAYSLTLQGLGIRWLGLRSLRELGSGLALIHRNARLCFVHTV
PWDQLFRNPHQALLHSANRPEVECVGEGLACYPLCAHGHCWGPGPTQCVNCSQFLRGQQC
VEECRVLQGLPREYVKDRYCLPCHPECQPQNGSVTCFGSEADQCVACTHYKDPPFCVARC
PSGVKPDLSFMPIWKFPDEEGMCQPCPINCTHSCVDLDDKGCPAEQRASPVTSIIAAVVG
ILLVVVVGLVFGILVKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPPSPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGSGGTAHHRHRSTSTRSGGGELTLGLEPSEEEPPTSPLAPSEG
AGSDVFDGDLGMGAAKGLQNLPQHDSSPLQRYSEDPTEPLPPETDGYVAPLTYSPQPEYV
NQPEVRPQPPSPLEGPRPPPRPAGSTLERPKTLSPGKNGVVKDIFAFGAAVENPEYLAPR
GRAAPQSHSSPAFSPAFDNLYYWDQDPSERGSPPSTFEGTPTAENPEYLGLDMPV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcctcctcgccctcctgccccccggagcc
gcgggcacccaagtgtgcaccggcacagacatgaagctgcggccgctggccagtcccgag
acccacctggacatgctccgccacctctaccagggctgtcaggtggtgcagggtaacctg
gagctcacctacctgcccgctaatgccagcctttccttcctgcaggagatccaggaggtg
cagggctacgtgctcatcgctcagaaccgagtgagtcaggtccccctgcagaggctgcgg
atcgtgcgaggcacccagctctttgaggacaactatgccctggccgtgctggacaacgga
ggccttctggaaggtgccccccctgctgcacgcgctgctccgggagggctgcaggagctg
cagctgcgaagcctcacagagatcctgaagggaggggtcttgatccagcggaacccccag
ctctgccaccaggacacgattgtgtggaaggacatcttccacaggaacaaccagctggcc
ctcatgcagatagacaccaaccgctcacgggcctgcccaccctgttctccagcttgtaaa
gctccccactgctggggagaaagttccaaggactgtcagagcttgacgcgaaccgtctgt
gccagcggctgtgcccgctgtaagggcccgcagcccaccgactgctgccacgagcagtgt
gctgccggctgcacgggccccaagcactctgactgtctggcctgcctccacttcaaccac
agtggcatctgtgagctgcactgcccagctctggtcacctacaacacggacaccttcgag
tccatgcccaaccccgagggccgttataccttcggcgccagctgcgtgaccacctgtcct
tacaactacctgtccacggacgtgggatcctgcaccctggtttgtcccctgaacaaccaa
gaggtgacagctgaggatggaacccagcggtgtgagaaatgcagcaagccctgtgcccga
gtgtgctatggtctgggcatggaacacctgcgggaggtgagggcggtcaccagtgccaac
atccaggagtttgctggctgcaagaagatctttgggagcctggcgtttgtgccggagagc
tttgagggggaccaagcctccaacactgcccccctacagcctgagcagctcagagtattt
gagtctctggaggagatcacaggttacctgtacatctcagcgtggccagacagcctgccg
gacctccacgtcttccagaatctgcgagtaatccggggacgagttctgcatgatggtgcc
tactcgctgaccctgcaagggctgggcatccgctggctggggctgcgctctctgcgggaa
ctgggcagtgggctggccctcatccaccgcaacgcccgcctctgctttgtacacacggtg
ccctgggaccagctcttccggaacccccaccaggccctgctccacagtgccaaccggcca
gaggtcgagtgcgtgggcgagggcctggcctgctacccgctgtgtgcccacgggcactgc
tggggtccagggcccacccagtgcgtcaactgcagccagttcctccggggccagcagtgc
gtggaagaatgccgagtactgcaggggctcccccgggagtacgtgaaggacaggtactgt
ctgccgtgccaccccgagtgtcagccccagaatggctcagtgacctgctttggctcggag
gctgaccagtgtgtggcttgcacccactacaaggatcctcccttctgcgtggctcgctgc
cccagtggtgtgaagcctgacctctccttcatgcccatctggaagttcccagatgaggag
ggcatgtgccagccatgccccatcaactgcacccactcctgtgtggacctggatgacaag
ggctgccccgctgagcagagagccagccccgtgacgtccatcattgccgctgtggtgggc
attctgctggtcgtcgtcgtggggctggtcttcggcatcctcgtcaagcggcggcggcag
aagatccgaaagtacacgatgcggcggctgctgcaggagacagagctggtggagcccctg
acaccgagcggagcgatgccaaatcaggctcagatgcggatcctgaaagagacagagctg
aggaaggtgaaggtgcttggatccggagcttttggtaccgtctacaagggcatctggatc
cccgatggggaaaatgtgaaaatcccagtggccatcaaagtgttgagggaaaacacatcc
cccaaagccaacaaagaaatcttggacgaagcatatgtgatggctggtgtagggtcccca
tacgtgtcccgccttctgggcatctgcctgacatccacggtgcagctggtgacacagctt
atgccctatggctgcctcctagaccacgtccgggagcaccgcgggcgcctgggctcccag
gacctgctgaactggtgtgtgcagattgccaaggggatgagctacttggaggatgtgcgg
ctcgtgcacagggacctagctgcccggaatgtgctggtcaagagtcccaaccatgtcaag
attacagacttcgggctggctcggctgctggacattgatgagacagagtaccatgcggat
gggggcaaggtgcccatcaagtggatggcgttggagtccattctccgccggcggttcacc
caccagagtgatgtgtggagctatggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttacgatgggatcccagcccgggagatccctgacctcctggagaagggggagcgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
atcgactctgaatgtcggccaaggttccgggagttggtggccgaattctcccgcatggcc
agggacccccagcgctttgtggtcatccagaatgaagacttgggccctcccagccccttg
gacagcaccttctaccgctcgctgctggaggatgatgacatgggggacctggtggatgct
gaggagtacctggtaccccagcaaggcttcttctgcccagaccctgccccgggctctggg
ggcacagcccaccacaggcaccgcagcacatccaccaggagtggcggtggtgagctgacg
ctgggtctggagccctcggaggaggagccccccacgtctccactggcaccttccgaaggg
gctggctctgatgtgtttgacggcgacttgggaatgggggcagccaaggggctgcagaac
ctcccccaacatgactccagccctctacagcggtacagcgaggaccccacagaaccgctt
cctcccgagaccgatggctacgttgcccccctgacctacagcccccagcccgaatacgtg
aaccagccagaggttcggccacagcccccctcacccctagagggtcctcggcctcctcct
cgacctgccggttccactctggaaaggcccaagactctctcccctgggaagaatggggtt
gtcaaagacatttttgcctttggggctgccgtggagaaccccgagtacttggcaccccgg
ggcagggctgcccctcagtcccactcttctccggccttcagcccagcctttgacaacctc
tattactgggaccaggacccatcagagcggggctctccacccagcacctttgaagggacc
cctacagcagagaaccctgagtacctgggtctggacatgccagtatga

DBGET integrated database retrieval system