KEGG   Orcinus orca (killer whale): 101284249
Entry
101284249         CDS       T05247                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04012  ErbB signaling pathway
oor04066  HIF-1 signaling pathway
oor04072  Phospholipase D signaling pathway
oor04136  Autophagy - other
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04152  AMPK signaling pathway
oor04211  Longevity regulating pathway
oor04213  Longevity regulating pathway - multiple species
oor04218  Cellular senescence
oor04371  Apelin signaling pathway
oor04630  JAK-STAT signaling pathway
oor04659  Th17 cell differentiation
oor04714  Thermogenesis
oor04910  Insulin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04920  Adipocytokine signaling pathway
oor04930  Type II diabetes mellitus
oor04931  Insulin resistance
oor04935  Growth hormone synthesis, secretion and action
oor05010  Alzheimer disease
oor05014  Amyotrophic lateral sclerosis
oor05016  Huntington disease
oor05017  Spinocerebellar ataxia
oor05022  Pathways of neurodegeneration - multiple diseases
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05168  Herpes simplex virus 1 infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05212  Pancreatic cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05221  Acute myeloid leukemia
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101284249 (MTOR)
   04371 Apelin signaling pathway
    101284249 (MTOR)
   04630 JAK-STAT signaling pathway
    101284249 (MTOR)
   04066 HIF-1 signaling pathway
    101284249 (MTOR)
   04072 Phospholipase D signaling pathway
    101284249 (MTOR)
   04151 PI3K-Akt signaling pathway
    101284249 (MTOR)
   04152 AMPK signaling pathway
    101284249 (MTOR)
   04150 mTOR signaling pathway
    101284249 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101284249 (MTOR)
   04136 Autophagy - other
    101284249 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    101284249 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101284249 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101284249 (MTOR)
   04920 Adipocytokine signaling pathway
    101284249 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    101284249 (MTOR)
   04919 Thyroid hormone signaling pathway
    101284249 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    101284249 (MTOR)
   04213 Longevity regulating pathway - multiple species
    101284249 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    101284249 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101284249 (MTOR)
   05206 MicroRNAs in cancer
    101284249 (MTOR)
   05205 Proteoglycans in cancer
    101284249 (MTOR)
   05230 Central carbon metabolism in cancer
    101284249 (MTOR)
   05231 Choline metabolism in cancer
    101284249 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101284249 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101284249 (MTOR)
   05212 Pancreatic cancer
    101284249 (MTOR)
   05225 Hepatocellular carcinoma
    101284249 (MTOR)
   05226 Gastric cancer
    101284249 (MTOR)
   05214 Glioma
    101284249 (MTOR)
   05221 Acute myeloid leukemia
    101284249 (MTOR)
   05215 Prostate cancer
    101284249 (MTOR)
   05224 Breast cancer
    101284249 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101284249 (MTOR)
   05014 Amyotrophic lateral sclerosis
    101284249 (MTOR)
   05016 Huntington disease
    101284249 (MTOR)
   05017 Spinocerebellar ataxia
    101284249 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    101284249 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101284249 (MTOR)
   04931 Insulin resistance
    101284249 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101284249 (MTOR)
   05168 Herpes simplex virus 1 infection
    101284249 (MTOR)
   05163 Human cytomegalovirus infection
    101284249 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101284249 (MTOR)
   05165 Human papillomavirus infection
    101284249 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101284249 (MTOR)
   01522 Endocrine resistance
    101284249 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101284249 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101284249 (MTOR)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101284249 (MTOR)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   101284249 (MTOR)
Membrane trafficking [BR:oor04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    101284249 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 101284249
NCBI-ProteinID: XP_004272435
LinkDB
Position
Unknown
AA seq 2548 aa
MLGTGPAAAATATTASSNVSVLQQFACGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLGKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAMQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRVKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNVATAATTAATATATSTEGSNSESEAENTENSPT
PSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNE
ALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASK
STTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGE
RNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAW
DLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQ
VITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLS
IQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLM
QKVEVFEHAVNNTAGDDLARLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHP
SNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCH
TVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGV
ELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETLDV
PTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7647 nt   +upstreamnt  +downstreamnt
atgcttggaaccggccctgccgccgctgccacagctaccaccgcatccagcaatgtgagc
gtcctgcagcagtttgcctgcggcctgaagagccggaacgaggagaccagggccaaagcc
gccaaggagctccagcactatgtcaccatggagctccgagagatgagtcaagaagagtct
actcgcttctatgatcagctgaaccatcacatttttgaactggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggtgggaat
gccacccgaatcggaagatttgctaactaccttcggaacctcctcccctccaatgaccca
gttgtcatggaaatggcatccaaggccattggtcgcctcgccatggcaggggacactttt
accgctgagtatgtggagtttgaggtgaagcgagccttggaatggctgggtgctgaccgc
aacgagggccggagacatgcggctgtcctggttcttcgtgagctggccatcagcgtcccc
accttcttcttccagcaagtgcagcccttctttgacaatatttttgtggccgtgtgggac
cccaaacaggccatccgtgagggagctgttgctgcccttcgtgcctgtctgatcctcacc
acccagcgggagccaaaggagatgcagaagccacagtggtacaggcacacgtttgaggaa
gcagagaaggggtttgacgagaccttgggcaaggagaagggcatgaatcgcgatgatcgg
atccacggagccttactgatcctcaacgagctggttcgcatcagcagcatggagggagag
cgcctgagagaagaaatggaagaaatcacacagcagcaattggtacatgacaagtactgc
aaggatctcatgggcttcggaacgaaacctcgtcacatcacccccttcaccagtttccag
gccatgcagccccagcagtcaaacgccttggtgggactgctggggtacagctctcaccaa
ggcctcatgggcttcggggcttcccccagcccagcgaagtccaccctggtggagagtcgc
tgctgcagagacttgatggaggagaaatttgatcaggtgtgccagtgggtgctgaagtgc
aggaatagcaagaactcgctgatccaaatgacaatcctgaatttgttgccccgcttggct
gccttccgaccttctgccttcacagatacccagtatctccaagataccatgaaccatgtc
ctaagctgtgtcaagaaggagaaggaacggacagcagccttccaagccctggggctactt
tctgtggctgtgaggtctgagtttaaggtctacttacctcgtgtgctggacatcatccga
gcagccctgcctcctaaggactttgcccataagagacagaaggcaatgcaggtggatgcc
acggtgttcacctgcatcagcatgctggcccgagcgatggggccgggcatccagcaggac
atcaaggagctgctggagcccatgctggcggtgggcctgagccctgccctcacagctgtg
ctctacgacctgagccgtcagattccacagctgaaaaaggacatccaagatggactcctg
aagatgctgtccctggtccttatgcacaaacccctccggcacccaggcatgcccaagggc
ctggcccatcagctggcttctcctggcctcacgaccctccctgaggccagcgatgtgggc
agcattacccttgccctccgaactcttggcagttttgaatttgaaggccactctctgacc
cagtttgtccgccactgtgcggatcacttcctgaacagcgagcacaaggagatccgcatg
gaagccgcccgcacctgctctcgcctgctcacgccctctgtccacctcatcagtggccat
gctcacgtggttagccagaccgcagtgcaagtggtggcggatgtgctcagcaaactgctc
gtggttgggataacagatcctgaccccgacatccgctactgtgtcttggcatccctggat
gagcgctttgacgcacacctggcccaggcagagaacctgcaggccctgtttgtggccctg
aatgaccaggtgtttgagatccgggagctggccatctgcactgtgggccggctcagcagc
atgaacccagccttcgtcatgcccttcctgcgcaagatgctcatccagattttgacagag
ctggagcacagcggcattggaagagtcaaggaacagagtgcccgcatgctggggcacctg
gtctccaatgccccccgactcatccgcccctacatggagcctattctgaaggctttaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcctggct
acaataggagagttggctcaggttagtggcctagaaatgaggaagtgggttgatgaactt
tttattatcatcatggacatgctccaggactcctctctgttggccaaaaggcaggtggct
ctgtggaccctaggacagttggtggccagcactggctacgtggtggagccctacaggaag
taccccacattgcttgaggtgctgctgaatttcctgaagactgagcagaaccagggtaca
cggcgagaggctatccgtgtgttagggctcttgggggccttggatccctacaagcacaaa
gtgaacattggcatgatcgaccagtcccgggatgcttctgctgtcagcctgtcagaatcc
aagtcaagtcaggattcctctgactacagcaccagtgagatgctggtcaacatggggaac
ttgcctctggacgagttctacccagccgtgtccatggtggccctgatgcgcatcttccga
gaccagtccctctctcaccatcacaccatggtcgtccaggccatcaccttcatcttcaag
tccctggggctcaagtgtgtgcagttcctgccccaggtcatgcccacattcctgaatgtc
attcgggtttgtgacggggccatccgggaatttctgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcaggccttacatggatgaaatagtcacactcatgagagaa
ttctgggtcatgaacacctccatccagagcacgatcattcttctcattgagcagattgtg
gtagctcttgggggtgaatttaagctctacctgccccagctgatcccacacatgctacga
gtcttcatgcatgacaatagcccaggccgcatcgtctccatcaagttgcttgctgcaatc
cagctgtttggcgccaacctggatgactatctgcatctgttactgccccctatcgtgaag
ttgtttgatgcccctgaagttccattgccatctcgaaaggcagcgttagagacagtggac
cgcctgacggagtccctggatttcactgactatgcctctcggatcattcacccgattgtg
cgaacgctggaccagagcccagaactccgtcccacagccatggacacgttgtcctcactc
gtgtttcagctggggaagaagtaccaaattttcattccaatggtaaataaagttctggtg
cgacaccgaatcaaccatcagcgctatgatgtcctcatctgcaggattgtcaagggatac
acccttgctgatgaagaagaggaccctttgatttaccagcatcgaatgctgcggagtggc
caaggggatgccttggctagcggaccagtggaaacgggacccatgaagaaactgcacgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtctccaaagatgattgg
ttggaatggctgaggcggctgagcctggagctgctgaaggactcctcctcgccctccctg
cgctcctgctgggccctggcacaggcctacaacccgatggccagggatctctttaacgct
gcgtttgtgtcctgctggtctgagctgaatgaagaccagcaggatgagctcatcagaagc
atcgagttggccctcacctcccaggacatcgctgaagtcacacaaaccctcttaaacttg
gctgaattcatggaacacagtgacaagggccccctgccattgagggatgacaatggcatt
gttctgctgggtgagagggctgccaagtgccgagcatatgccaaagcgctacactacaaa
gaactggagttccagaagggtcccacccctgccatcctagagtctctcatcagcattaat
aataagctacagcagccagaggcagctgccggggtattagaatatgccatgaaacacttc
ggagagctggagattcaggctacctggtatgagaaactgcatgagtgggaggatgctctt
gtggcctacgataagaaaatggacaccaacaaggatgacccagagctgatgctgggccgc
atgcgctgcctcgaggccttgggggaatgggggcagctccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccggatggctgctgcagctgca
tggggtttaggtcagtgggacagcatggaggagtacacctgcatgatccctcgggatacc
cacgacggggcgttttacagagccgtgctggcgctgcatcaggacctcttctccttggcg
cagcagtgcatcgacaaagcccgggacctgctggacgctgagttaactgcgatggcagga
gagagctacagccgggcgtatggggccatggtttcttgccacatgctctccgagctggag
gaggtcatccagtacaaacttgtccccgagcgccgggagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtattgtggaggactggcagaaaatcctcatggtgcgg
tcgctagtggtcagccctcacgaggacatgaggacctggctcaagtatgcaagcctgtgt
ggcaagagtggcaggctggctcttgctcataaaaccttagtgctgctcctgggagttgat
ccatctcggcaacttgaccaccctctgccaacagttcacccccaggtgacctacgcctac
atgaaaaatatgtggaagagcgctcgcaagatcgatgccttccagcacatgcagcacttt
gttcagaccatgcagcagcaagcccagcacgccatcgccaccgaggaccagcagcacaag
caggagctgcacaagcttatggcccgatgtttcctgaaactcggggagtggcagctgaac
ctgcagggcatcaacgagagcacgatccccaaagtcctgcagtattatagcgccgccacg
gagcacgaccgcagctggtacaaggcctggcacgcgtgggctgtgatgaacttcgaggct
gtgctccactacaaacatcagaaccaagcccgcgatgagaagaagaaactgcgtcacgcc
agtggggccaacatcaccaacgtggccactgccgccaccacggcggccacggccactgcc
accagcaccgagggtagtaacagcgagagcgaggctgaaaacactgagaacagccctacc
ccatctcctctgcagaagaaggtcactgaggatttgtccaaaactctcttgatgtacacc
gtccctgctgtccagggcttcttccgatccatctctttgtcacgaggcaacaacctccag
gacacgctcagagtcctcaccttatggtttgattatggtcactggccagatgtaaatgaa
gccttagtggaaggggtgaaagcgatccagattgacacttggttacaggttatacctcag
ctcattgcgagaattgatacgccgaggcccttggtgggacgtctcattcaccagcttctc
acagacattggtcggtaccacccccaggccctcatctacccgctgacggtggcttctaag
tccaccaccacggcccgtcacaatgcggccaacaagattctgaagaacatgtgcgagcac
agtaacaccttggtgcaacaggccatgatggtgagtgaggagctgatccgagtggccatt
ctctggcacgagatgtggcacgaaggcctggaagaggcatctcgcttgtactttggggag
aggaacgtgaaaggcatgttcgaggtgctggagcccctgcatgctatgatggagcgggga
ccccagactctgaaggaaacatcctttaaccaggcgtatggtcgagatttaatggaggcc
caagagtggtgcaggaagtacatgaaatcagggaatgtcaaggacctcacccaagcctgg
gacctctattaccacgtgttcagacgaatctcaaagcagctgcctcagctcacatcctta
gagctgcaatacgtgtccccaaaacttctgatgtgccgggacctggaattggctgtgccg
ggaacatatgaccccaaccagccgatcattcgcattcagtccattgcaccatctctacaa
gtcatcacatccaagcagaggccccggaagttgacgcttatgggcagcaacgggcacgag
tttgtcttcctcctgaagggccatgaagatctgcggcaggacgagcgagtgatgcagctc
ttcggcctggtcaacacccttctggccaatgacccaacatctcttcggaaaaacctcagc
atccagagatatgctgtcattcccttatcaaccaattcgggcctcatcggctgggtcccc
cactgtgacacgctgcacgccctcatccgggactacagggagaaaaagaagatccttctc
aacatcgagcatcgcatcatgctgcggatggctccagactacgaccacctgactctgatg
cagaaggtcgaggtgtttgagcacgccgtcaacaacacagctggggacgacctggccagg
ctgctgtggctgaagagccccagctccgaggtgtggtttgatcgaagaaccaattacacc
cgttctttagcagtcatgtccatggttgggtatattttgggcctgggcgatagacaccca
tccaacctgatgctggaccggctgagcgggaagatcctgcacattgactttggggactgc
tttgaggttgctatgaccagagagaagttcccagagaagattccatttagactaacgaga
atgttgaccaatgctatggaggtcacgggcctggacggcaactacagaatcacatgccac
acggtgatggaagtgcttcgggagcacaaggacagcgtcatggctgtgctggaagccttc
gtctatgaccccttgctgaactggaggctgatggacacaaataccaaaggcaacaagcga
tcacgaacgaggacagattcctactctgctggccagtcagtagaaattttggatggtgtg
gaacttggggaaccagcccataagaaaacagggaccacagtgccagaatctattcattct
ttcattggagacggtttggtgaaaccagaggccctaaataagaaagctattcagattatt
aacagagttcgagataagctcactggtcgggacttctctcacgatgaaacgttggatgtc
ccaacacaagttgagctgctcatcaaacaagcaacatcccatgaaaacctctgccagtgc
tacatcggctggtgtcctttctggtaa

DBGET integrated database retrieval system