KEGG   Orcinus orca (killer whale): 101284496Help
Entry
101284496         CDS       T05247                                 

Gene name
GYS1
Definition
(RefSeq) glycogen [starch] synthase, muscle isoform X1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00500  Starch and sucrose metabolism
oor01100  Metabolic pathways
oor04151  PI3K-Akt signaling pathway
oor04152  AMPK signaling pathway
oor04910  Insulin signaling pathway
oor04922  Glucagon signaling pathway
oor04931  Insulin resistance
Module
oor_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101284496 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101284496 (GYS1)
   04152 AMPK signaling pathway
    101284496 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101284496 (GYS1)
   04922 Glucagon signaling pathway
    101284496 (GYS1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    101284496 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:oor01003]
    101284496 (GYS1)
Enzymes [BR:oor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101284496 (GYS1)
Glycosyltransferases [BR:oor01003]
 Polysaccharide
  Storage polysaccharide
   101284496 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 101284496
NCBI-ProteinID: XP_004271112
LinkDB All DBs
Position
Unknown
AA seq 737 aa AA seqDB search
MPLNRSLSVSSLPGLEDWDDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREGNDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRGLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEQFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDGPPDEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTGGSKRGSVDTAPSSSVS
TPSEPLSPASSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaaccgcagtttgtccgtgtcctcactgccaggactggaggattgggacgat
gaattcgacctggagaacacagtgctctttgaggtggcctgggaggtggccaacaaggtg
ggtggcatctacacggtgctgcagacgaaggcgaaggtgacaggggatgagtggggcgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggaactgctc
gagcccccgaccccagccctgaagaggacgctggactccatgaacagcaagggctgcaag
gtgtatttcgggcgctggctgatcgaggggggccccctggtggtgcttctcgacgtgggg
gcctcagcctgggccctggagcgctggaagggggagctatgggacacgtgcaacatcggg
gtgccctggtatgaccgggaaggcaacgacgccgtcctttttggtttcctcaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaaaccacatgtggttgcacacttccat
gagtggttggcgggcatcgggctctgcctatgccgtgcccggcggctgcccgtggctacc
atcttcacgacccacgccacgctgctggggcgatacctgtgtgccggtgccgtggacttc
tacaacaacctggagaatttcaacgtggacaaggaagcaggtgagaggcaaatctatcac
cgctactgcatggagcgggcggcagcccactgcgctcatgtcttcactaccgtgtcccag
attaccgccattgaggctcagcacctactcaaaaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaaattctctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcacctggacttcaacttg
gacaagaccttgtacttctttatcgctggccgctatgaattctccaacaagggggccgat
gtcttcctggaggccttggcccggctcaactatctgctcagagtgaatggcagcgagcag
acagtggttgccttcttcatcatgccagctcggaccaacaatttcaacgtggaaaccctt
aagggccaagccgtgcgcaagcagctttgggatacggccaacacagtgaaggagaagttt
gggaggaagctttatgaatccttgctggtggggagcctcccagacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagccatctttgccacgcagcggcagtctttc
cctcctgtgtgcacccacaatatgctggacgactcctcagatcctattttgaccaccatc
cgccgaattggcctcttcaatagtagtgccgacagggtcaaggtgatttttcacccggag
ttcctctcctccacgagccccctgctccctgtggactatgaggagtttgtccgcggctgc
cacctgggcgtcttcccctcctactatgagccttggggctacacaccagctgagtgcacg
gttatgggtatccccagtgtctccaccaacctttctggtttcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggcatctacattctggaccggcgtttccgaggcctg
gatgattcttgctcgcagctcacctccttcctctacagtttctgccagcagagccggcgg
cagcgcattatccagcggaaccgcacggagcgcctctccgaccttctggactggaaatac
ctaggccggtactacatgtctgcgcgccacatggcgctggccaaggcctttccagaacag
ttcacctacgagccccacgaggctgatgcgacccagggctaccgctacccgcggccagcc
tcagtgccaccatcgccctcactgtcgagacactccagcccgcaccagagcgaggatgag
gaggagccccgggacggaccacccgatgaagatggcgagcgctacgacgaggacgaggag
gctgccaaggaccggcgcaatatccgcgccccggagtggccgcgccgcgcctcctgcacg
tcctcaaccggcgggagcaagcgcggctcggtggacacagcgccctccagctcagtcagc
acccccagcgagcccctcagccccgccagctccctgggcgaggagcgcaactaa

DBGET integrated database retrieval system