KEGG   Orcinus orca (killer whale): 101284580
Entry
101284580         CDS       T05247                                 

Gene name
SOS2
Definition
(RefSeq) son of sevenless homolog 2 isoform X1
  KO
K03099  son of sevenless
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04062  Chemokine signaling pathway
oor04068  FoxO signaling pathway
oor04072  Phospholipase D signaling pathway
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04510  Focal adhesion
oor04540  Gap junction
oor04630  JAK-STAT signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04714  Thermogenesis
oor04722  Neurotrophin signaling pathway
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04912  GnRH signaling pathway
oor04915  Estrogen signaling pathway
oor04917  Prolactin signaling pathway
oor04926  Relaxin signaling pathway
oor04935  Growth hormone synthesis, secretion and action
oor05034  Alcoholism
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101284580 (SOS2)
   04012 ErbB signaling pathway
    101284580 (SOS2)
   04014 Ras signaling pathway
    101284580 (SOS2)
   04630 JAK-STAT signaling pathway
    101284580 (SOS2)
   04068 FoxO signaling pathway
    101284580 (SOS2)
   04072 Phospholipase D signaling pathway
    101284580 (SOS2)
   04151 PI3K-Akt signaling pathway
    101284580 (SOS2)
   04150 mTOR signaling pathway
    101284580 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101284580 (SOS2)
   04540 Gap junction
    101284580 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101284580 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101284580 (SOS2)
   04660 T cell receptor signaling pathway
    101284580 (SOS2)
   04662 B cell receptor signaling pathway
    101284580 (SOS2)
   04664 Fc epsilon RI signaling pathway
    101284580 (SOS2)
   04062 Chemokine signaling pathway
    101284580 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101284580 (SOS2)
   04912 GnRH signaling pathway
    101284580 (SOS2)
   04915 Estrogen signaling pathway
    101284580 (SOS2)
   04917 Prolactin signaling pathway
    101284580 (SOS2)
   04926 Relaxin signaling pathway
    101284580 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    101284580 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101284580 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101284580 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101284580 (SOS2)
   05206 MicroRNAs in cancer
    101284580 (SOS2)
   05205 Proteoglycans in cancer
    101284580 (SOS2)
   05231 Choline metabolism in cancer
    101284580 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101284580 (SOS2)
   05225 Hepatocellular carcinoma
    101284580 (SOS2)
   05226 Gastric cancer
    101284580 (SOS2)
   05214 Glioma
    101284580 (SOS2)
   05221 Acute myeloid leukemia
    101284580 (SOS2)
   05220 Chronic myeloid leukemia
    101284580 (SOS2)
   05211 Renal cell carcinoma
    101284580 (SOS2)
   05215 Prostate cancer
    101284580 (SOS2)
   05213 Endometrial cancer
    101284580 (SOS2)
   05224 Breast cancer
    101284580 (SOS2)
   05223 Non-small cell lung cancer
    101284580 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    101284580 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101284580 (SOS2)
   05160 Hepatitis C
    101284580 (SOS2)
   05163 Human cytomegalovirus infection
    101284580 (SOS2)
   05165 Human papillomavirus infection
    101284580 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101284580 (SOS2)
   01522 Endocrine resistance
    101284580 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:oor04990]
    101284580 (SOS2)
Domain-containing proteins not elsewhere classified [BR:oor04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   101284580 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_19 PH_13
Other DBs
NCBI-GeneID: 101284580
NCBI-ProteinID: XP_004270083
LinkDB
Position
Unknown
AA seq 1332 aa
MQQAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPNLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRDLFKPSDI
EKIFSNILDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPKFNEHFSKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEHEDRECLNQAITALMNLQGSMDRIYKQYSPRRRPGDPVCPFYNRQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHSQSRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCECKHAFELVSKDENSIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKLA
VEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILD
EAVELSQDHFKKYLLKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGNASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDHDASNSKGTMKSDDDPPAIPPRQPPPPKVKPRVPAPSGAFDGLL
HSPPPPPPRDPLPDTPPPVPLRPPEHFINCPFTLQPPPLGHLHRDPDWFRDVSTCPNSPN
TPPSTPSPRVPRRCYVLSSSQNNLAHPQAPPVPPRQNSSPHLPKLPPKTYKRELSHPPLY
RLPLLENAETTQ
NT seq 3999 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccgtacgagttcttcagcgaagagaacagtccgaaatggcgg
ggactgttggtctcggccctgcggaaggttcaggagcaagtacatcccaatctctcagct
aatgaagagtctctctattatattgaagagctgatttttcagctgcttaataaattatgc
atggcccaaccaaggactgttcaagatgtggaggaacgagttcaaaagacctttcctcat
ccaattgataaatgggctattgctgatgcacagtctgccatagagaaacgaaaacgaaga
aatcctctcttactgcctgtggacaaaatccatccttcattgaaggaagttttagggtac
aaagtggactaccatgtgtccttatatattgtggctgtactagagtatatctcagctgat
attttgaaattggctggtaattatgtttttaatatccgacattatgaaatatcccaacag
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggcttggtttctctttgtgaagatgaacctagttcttcaggtgaattaaactactat
gaccttgtcagaactgaaattgcagaagaaagacagtatctacgggaactaaatatgatc
ataaaagtgtttcgagaagcttttctttctgacagagacctgtttaaaccttctgatatt
gaaaagattttcagtaacattttagatatacatgaattgaccgtgaaacttttaggttta
attgaagacacagttgaaatgacagatgaaagcagccctcatcccttagctggaagctgt
tttgaagatttggcagaggaacaagcatttgatccttatgaaacattatcacaggatatt
ctttcaccaaaatttaatgaacatttcagtaagttgatggccagacctgcagtggctcta
cactttcagtccattgctgatggttttaaagaggcagttcgttatgtccttccacgcctt
atgctggtgccagtatatcattgttggcactattttgaattattaaagcaattgaaagca
tgtagtgaagagcatgaagacagagaatgtttgaaccaagctattactgctcttatgaat
ctccaaggtagtatggaccgaatttacaagcagtattcacctagacgccgacctggggat
cctgtttgccctttttataatcgtcaattaagaagcaagcacctggctattaaaaaaatg
aatgaaattcagaaaaacatagatggatgggaaggcaaagatattggacagtgttgtaat
gaatttattatggaaggcccattgacaagaattggtgctaaacacgaacggcacattttt
ctctttgatggcttaatgattagctgcaaacccaatcatagccagtcacgccttccagga
tacagtagtgcagaatacagattaaaagaaaaatttgtcatgaggaaaatacaaatatgt
gataaagaagatacttgtgagtgcaaacatgcttttgaattagtatccaaagatgaaaac
agcataatatttgctgctaagtctgctgaagagaaaaataattggatggcagcacttatt
tctcttcattatcgtagtactctagatcgaatgctagattcagtattactgaaggaagaa
aatgaacaaccacttagattaccgagtcctgaagtgtatcgttttgtggtaaaagactct
gaggaaaacattgtttttgaagacaacttgcaaagtagaagtggaatccccattattaaa
ggaggaactgtggtgaaattaattgaaaggttaacatatcacatgtatgcagatcccaat
tttgttcgcacttttcttactacgtatcgttcattttgtaaaccacaggaattgctaagc
ttactgattgaacgatttgaaattccagagccagaacctactgaagcagataaattggca
gtagagaaaggcgagcagccaatcagtgcagaccttaaaaggtttcgcaaggaatatgtc
caaccagtacaacttaggatcttaaatgtgtttcggcactgggttgaacaccatttttat
gactttgaaagagacttggagttgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaagctatgaagaaatgggtagagtcaattgctaagatcatcaagaggaagaaacaa
gctcaggcaaatggaataagccataatattacctttgaaagtccacctccaccaattgaa
tggcatatcagcagaccaggacagtttgaaacgtttgatctcatgacacttcatccaata
gaaattgcacgtcagctgacacttttggaatctgatctctacaggaaagttcaaccttct
gaacttgtagggagtgtatggaccaaagaagataaagaaataaattctccaaatttatta
aaaatgattcgccacaccacaaatctcactctctggtttgaaaagtgcattgtggaagca
gaaaattttgaggaacgggtggcagtactaagtagaataatagaaattctgcaagttttt
caagatttgaataatttcaatggtgtattagagatcgtcagtgcagtaaattcagtatca
gtctatagactagatcatacctttgaggcattgcaggaaagaaaaaggaaaattttggat
gaagctgtggaattaagtcaagatcattttaaaaaatatctattgaaacttaagtcaatc
aatccaccttgtgtgcctttttttggaatatatttaacaaatattctgaagactgaagaa
gggaataatgattttttaaaaaagaaagggaaagatttaatcaatttcagtaagaggagg
aaagtagctgaaattactggagaaattcagcaatatcagaatcaaccttactgtttacgg
atagaaccagaaatgaggaggttctttgaaaaccttaaccccatgggaaatgcttctgaa
aaagagtttacagattatctgttcaacaagtcactagaaattgaaccccggaactgcaaa
cagccacctcgatttcctaggaaatcaactttctctttaaaatctcctggaataaggcct
aatacaggccgacatggctctacctcaggtactttacgaggtcatccaacaccattagaa
agagaaccatgtaaaataagctttagtcggattgctgaaacagagcttgaatcaacagtg
tcagcaccaacctctccaaatacaccatctactccaccagtgtctgcttcttcagacctt
agtgtgtttttagatgtggatctcaacagttcctgtggaagcaatagcatctttgctcca
gtcctcttgcctcattcaaagtctttctttagttcgtgtggtagtttacataaactaagt
gaagagccactgattcctcctccacttcctcctcgaaaaaaatttgatcatgatgcttca
aattccaagggaactatgaaatctgatgatgacccccctgctattccgccaagacagcct
cctcctccaaaggtaaaacccagagttcctgctccttctggtgcatttgacgggcttctg
catagtccaccaccgccgccgccgagagatcctcttcccgatacccctccaccagttccc
cttcggcctccagaacactttataaactgtccgtttactcttcagccacctccactggga
catcttcacagagatccagactggttcagagacgttagtacgtgtccaaattctccaaac
actcctcctagcacaccctctccaagggtaccacgtcgatgctacgtgctcagttctagt
cagaataatcttgctcatcctcaagctccccctgttccaccaaggcagaattcaagccct
cacctaccaaaactgccaccaaagacttacaaacgggagctttcgcaccccccattgtat
agactgcctttgctagaaaatgcagaaactactcaatga

KEGG   Orcinus orca (killer whale): 101286587
Entry
101286587         CDS       T05247                                 

Gene name
SOS1
Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04062  Chemokine signaling pathway
oor04068  FoxO signaling pathway
oor04072  Phospholipase D signaling pathway
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04510  Focal adhesion
oor04540  Gap junction
oor04630  JAK-STAT signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04714  Thermogenesis
oor04722  Neurotrophin signaling pathway
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04912  GnRH signaling pathway
oor04915  Estrogen signaling pathway
oor04917  Prolactin signaling pathway
oor04926  Relaxin signaling pathway
oor04935  Growth hormone synthesis, secretion and action
oor05034  Alcoholism
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101286587 (SOS1)
   04012 ErbB signaling pathway
    101286587 (SOS1)
   04014 Ras signaling pathway
    101286587 (SOS1)
   04630 JAK-STAT signaling pathway
    101286587 (SOS1)
   04068 FoxO signaling pathway
    101286587 (SOS1)
   04072 Phospholipase D signaling pathway
    101286587 (SOS1)
   04151 PI3K-Akt signaling pathway
    101286587 (SOS1)
   04150 mTOR signaling pathway
    101286587 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101286587 (SOS1)
   04540 Gap junction
    101286587 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101286587 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101286587 (SOS1)
   04660 T cell receptor signaling pathway
    101286587 (SOS1)
   04662 B cell receptor signaling pathway
    101286587 (SOS1)
   04664 Fc epsilon RI signaling pathway
    101286587 (SOS1)
   04062 Chemokine signaling pathway
    101286587 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101286587 (SOS1)
   04912 GnRH signaling pathway
    101286587 (SOS1)
   04915 Estrogen signaling pathway
    101286587 (SOS1)
   04917 Prolactin signaling pathway
    101286587 (SOS1)
   04926 Relaxin signaling pathway
    101286587 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    101286587 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101286587 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101286587 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101286587 (SOS1)
   05206 MicroRNAs in cancer
    101286587 (SOS1)
   05205 Proteoglycans in cancer
    101286587 (SOS1)
   05231 Choline metabolism in cancer
    101286587 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101286587 (SOS1)
   05225 Hepatocellular carcinoma
    101286587 (SOS1)
   05226 Gastric cancer
    101286587 (SOS1)
   05214 Glioma
    101286587 (SOS1)
   05221 Acute myeloid leukemia
    101286587 (SOS1)
   05220 Chronic myeloid leukemia
    101286587 (SOS1)
   05211 Renal cell carcinoma
    101286587 (SOS1)
   05215 Prostate cancer
    101286587 (SOS1)
   05213 Endometrial cancer
    101286587 (SOS1)
   05224 Breast cancer
    101286587 (SOS1)
   05223 Non-small cell lung cancer
    101286587 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    101286587 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    101286587 (SOS1)
   05160 Hepatitis C
    101286587 (SOS1)
   05163 Human cytomegalovirus infection
    101286587 (SOS1)
   05165 Human papillomavirus infection
    101286587 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101286587 (SOS1)
   01522 Endocrine resistance
    101286587 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:oor04990]
    101286587 (SOS1)
Domain-containing proteins not elsewhere classified [BR:oor04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   101286587 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 101286587
NCBI-ProteinID: XP_004265079
LinkDB
Position
Unknown
AA seq 1333 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESSDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENVQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSSDTVFIQVTLPHGPRSASVSSISL
TKSTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSVSD
RTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHSNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccgtacgagtttttcagcgaggagaacgcgcccaagtggcgg
gggctgctggtgcctgcgctgaaaaaggttcaggggcaagttcatcctactcttgagtct
agtgatgatgctcttcagtatgttgaagaattaattttgcagttactaaatatgctgtgc
caagctcagccccgaagtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccagtcggctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaattcatcctttgttaaaggaggtcctaggttat
aaaattgaccaccaggtttctgtttacatagtagcagtattagaatacatttctgcagac
attttaaagctggtggggaattatgtgcgaaatatacggcattatgaaattacaaaacaa
gatattaaagtggcaatgtgtgctgataaggtattgatggatatgtttcatcaagatgta
gaagatataaatatattatctttaactgatgaagagccttccacctcaggagagcaaact
tattatgatttggtaaaagcatttatggcagaaattcgacaatacataagggaacttaat
ttaattataaaagtttttagagagccctttgtctccaattcaaaattgttttcagctaac
gatgtagaaaatatatttagccgtatagtggatatacatgaacttagtgtaaagttactg
ggccatatagaagatactgtagaaatgacagatgaaggcagtccccatccattagtagga
agttgctttgaagacttagcagaggaactggcatttgatccatatgaatcatatgctcga
gatattttacgacctggttttcatgatcgtttccttagtcagttatcaaagcctggagcg
gcactctatttgcagtcaataggcgaaggtttcaaagaagctgttcagtatgttttaccc
aggctacttctagcccctgtttaccactgtctacattactttgaacttctgaagcagtta
gaagaaaagagtgaagatcaagaagacaaggaatgtttgaaacaagcaataacagctttg
cttaatgttcagagtggtatggaaaaaatatgctctaaaagtcttgcaaaacgaagactg
agtgaatctgcatgtcggttttatagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcagaagaatattgatggttgggagggaaaagacattggacagtgt
tgcaatgagtttataatggaaggaactcttacacgtgtaggagccaaacatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagactt
cctggtgctagcaatgcagagtatcgtcttaaagaaaagttttttatgagaaaggtacaa
attaatgacaaagatgacaccaatgagtacaagcatgcttttgagataattttaaaagat
gaaaatagcgttatattttctgccaagtcagctgaagagaaaaacaattggatggcagca
ttgatatctttacagtaccggagtacactggaaaggatgcttgatgtgacaatgctacag
gaagaaaaggaggagcagatgaggctccctagtgctgatgtttatagatttgcagagcct
gactctgaagaaaatatcatatttgaagaaaacgtgcagcccaaagctggaattccaatt
atcaaagcaggaactgttattaaacttatagagaggctcacataccatatgtacgcagat
cccaattttgttcggacatttcttacaacatatagatccttttgtaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagagaatggagatcagcccttgagtgcagaactaaaaaggtttagaaaagaa
tatatacagcctgtacaactgcgagtattaaatgtatgtcggcactgggtagagcaccac
ttctacgattttgaaagagatgcagatcttttgcagcgaatggaggaatttattggaaca
gtaagaggtaaagcgatgaaaaagtgggttgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatggaccaggtcataatattacatttcagagttcaccccctaca
gttgagtggcatataagcagacctgggcacatagagacttttgacctgctcaccttacac
ccaatagaaattgctcgacaactcactttacttgaatcagatctatatcgagctgtacag
ccatcagaattagttggaagtgtgtggacaaaggaagacaaagaaattaattctcctaat
cttctgaaaatgatccggcataccactaatctcactctgtggtttgagaaatgtattgta
gaaactgaaaacttagaagaaagagtagctgtggtgagtcgaataattgagattctgcaa
gtctttcaagagctgaacaacttcaatggtgtccttgaggttgtcagtgctatgaactca
tcacctgtatacagactagaccacacgtttgagcaaataccaagtcgccaaaagaaaatt
ttagaagaagctcatgaactaagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatttatctaactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctaaaaaggcatggaaaagagcttataaactttagcaaa
aggaggaaagtagcagaaataacaggcgagatccagcagtaccaaaatcagccttattgt
ttacgagtagaatcagatatcaaaaggttctttgaaaacttgaatccaatgggaaatagt
atggaaaaagaatttacagattatcttttcaacaaatccctagaaatagaaccacgaaac
cctaagcctctcccaagatttccaaaaaaatatagctatcccctaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtactatgagacatcccacacctctgcagcaagagcca
aggaaaattagttatagtaggatccctgaaagtgaaacagaaagtacagcatctgcacca
aattctccaagaacaccgttaacacctcctcctgcttctggtgcttctagtaccacagat
gtttgcagcgtatttgattctgatcattcaagcccttttcactcaagcagcgataccgtc
tttatccaagttacactgccccatggcccaagatctgcttcagtatcatctataagttta
accaagagcactgatgaagtgcctgtcccccctcctgttcctccacgaagacgaccagaa
tctgccccagcggaatcttcgccatctaagatcatgtctaagcatttggacagcccccca
gcaattcctcctaggcaacccacatcaaaagcctattcaccacgatattcagtatcagac
cggacctctatatcagatcctcctgaaagccctcccttattacctccacgagaacccgtg
aggacacctgatgttttctcaagctcaccactacatctccaacctccccctttgggcaaa
aaaagtgaccatagtaatgccttcttcccaaacagcccttccccctttacaccacctcct
cctcaaacaccttctcctcacggcacaagaaggcatctgccatcaccaccattgacacaa
gaagtggaccttcattccattgctgggccgcctgttcctccacgacaaagcacttctcaa
catatccctaaactccctccaaaaacttacaaaagggagcatacacacccatccatgcac
agagatggaccaccactgttggagaatgctcattcttcctga

KEGG   Orcinus orca (killer whale): 105748221
Entry
105748221         CDS       T05247                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: son of sevenless homolog 2-like
  KO
K03099  son of sevenless
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04062  Chemokine signaling pathway
oor04068  FoxO signaling pathway
oor04072  Phospholipase D signaling pathway
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04510  Focal adhesion
oor04540  Gap junction
oor04630  JAK-STAT signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04714  Thermogenesis
oor04722  Neurotrophin signaling pathway
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04912  GnRH signaling pathway
oor04915  Estrogen signaling pathway
oor04917  Prolactin signaling pathway
oor04926  Relaxin signaling pathway
oor04935  Growth hormone synthesis, secretion and action
oor05034  Alcoholism
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105748221
   04012 ErbB signaling pathway
    105748221
   04014 Ras signaling pathway
    105748221
   04630 JAK-STAT signaling pathway
    105748221
   04068 FoxO signaling pathway
    105748221
   04072 Phospholipase D signaling pathway
    105748221
   04151 PI3K-Akt signaling pathway
    105748221
   04150 mTOR signaling pathway
    105748221
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105748221
   04540 Gap junction
    105748221
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105748221
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    105748221
   04660 T cell receptor signaling pathway
    105748221
   04662 B cell receptor signaling pathway
    105748221
   04664 Fc epsilon RI signaling pathway
    105748221
   04062 Chemokine signaling pathway
    105748221
  09152 Endocrine system
   04910 Insulin signaling pathway
    105748221
   04912 GnRH signaling pathway
    105748221
   04915 Estrogen signaling pathway
    105748221
   04917 Prolactin signaling pathway
    105748221
   04926 Relaxin signaling pathway
    105748221
   04935 Growth hormone synthesis, secretion and action
    105748221
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    105748221
  09159 Environmental adaptation
   04714 Thermogenesis
    105748221
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105748221
   05206 MicroRNAs in cancer
    105748221
   05205 Proteoglycans in cancer
    105748221
   05231 Choline metabolism in cancer
    105748221
  09162 Cancer: specific types
   05210 Colorectal cancer
    105748221
   05225 Hepatocellular carcinoma
    105748221
   05226 Gastric cancer
    105748221
   05214 Glioma
    105748221
   05221 Acute myeloid leukemia
    105748221
   05220 Chronic myeloid leukemia
    105748221
   05211 Renal cell carcinoma
    105748221
   05215 Prostate cancer
    105748221
   05213 Endometrial cancer
    105748221
   05224 Breast cancer
    105748221
   05223 Non-small cell lung cancer
    105748221
  09165 Substance dependence
   05034 Alcoholism
    105748221
  09172 Infectious disease: viral
   05161 Hepatitis B
    105748221
   05160 Hepatitis C
    105748221
   05163 Human cytomegalovirus infection
    105748221
   05165 Human papillomavirus infection
    105748221
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    105748221
   01522 Endocrine resistance
    105748221
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:oor04990]
    105748221
Domain-containing proteins not elsewhere classified [BR:oor04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   105748221
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF PH Histone IQ_SEC7_PH
Other DBs
NCBI-GeneID: 105748221
NCBI-ProteinID: XP_012390150
LinkDB
Position
Unknown
AA seq 1337 aa
MPQAPQPYEFVSEENSPKWRGLLVSALRKVQEQVHPNLSANEESLYYIEELIFQLLNXCM
AQPRTVEDVEERVQKTFPHPMDKWAIADAXSAIEKRKRRNPLXLPVDKIHPSLKEVLGYE
VDYHVSLYIVAVLEYISADILKLADNYVFNIQHYEISQQDIKVSMCADKDKVLMDMFDQD
DIGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFXEAFISDRKLSKLSD
IEKIFSNILAIHELTVKLLGLIEDTVEMTDESSPHPSAGSCFEDLAEEQAFDPYETLSQH
ILSPKFNEHFSKLMARPAVALPFQSIADGFKEALRYVLPRLMLVPVYHCWHYFELLKQLK
ACSEEHEDRECLNQAVTALMNLQGSVDRIYKQYSPRRXPGDPVCPFYNRQLRSKHLAIKK
MNEIQKNIDGWEDKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISHKPSHSQSHLP
GYSSTEYRLKEKFVMREIQICDKEDTCECKHAFELVSKDENSIIFAAKFAEEKNNWMAAL
ISLHYHSTLHRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPII
KGGTVVKLIERLTHHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPSEADKL
AVEKGEQPISADLKMFRKEYVQPVQLRILNVFRHRVEHHFYDFERGLELLERLESFISSV
RGKTMKNWVESVAKIIKRKKQAQANGISHNITFGSPPPPTEWHISRPGQFETFDLMTLHP
IEIAHQLILLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVE
AENFEERVAVLSRIIEILQVFQDLNNFSGVLEIVSAINSVSVCRLDHTFEERKRKFLDEA
VELSQDHFKKYLVKFKSISPPCVSFFGIYLTNIFXRLNIILKTEEGNNDFLKKKGKDLIN
FSKRKKVAEITGEIQQYQNQPYCLRIEPEMRRFFENLNPMGNASENEFTDYLFNKSLEIE
PRNCKQPPQFPRKSTFSLKSPGIRPNTGXHGSTSGTLRGHPTPLEREPRKISFSRIAETE
LASTVSAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGG
FHKRSEGPLIPPPLPPRKKFDHDASNSKGTMKSDDDPPAILPRQPPPPKVKPRVPAPSGA
FDGPLHSPPPPPPRDALPDTPPPVPLRPLERFINCLFTLQPPALGHLHRDPDWFRDVSTC
PNSPNTPPSTPSPRVPHRCYVLSSSQNNLAHPQAPPVPPRQNSSPHLPKLPPKTYKRELS
HPPLCRLPLLENAETPQ
NT seq 4014 nt   +upstreamnt  +downstreamnt
atgccgcaggcgccgcagccgtacgagttcgtcagcgaagagaacagtccgaaatggcgg
ggactgttggtctcggccctgcggaaggttcaggagcaagtacatcccaatctctcagct
aatgaagagtctctctattatattgaagagctgatttttcagctgcttaatntatgcatg
gcccaaccaaggactgttgaagatgtggaggaacgagttcaaaagacctttcctcatcca
atggataaatgggctattgctgatgcatagtctgccatagagaaacgaaaacgaagaaat
cctcttnnactgcctgtggacaaaatccatccttcattgaaggaagttttagggtacgaa
gtggactaccatgtgtccctgtatattgtggctgtactagagtatatctcagctgatatt
ttgaaattggctgataattatgtatttaatatccaacattatgaaatatcccaacaggac
attaaagtgtcaatgtgtgcagataaggataaggttttgatggacatgtttgatcaggat
gacataggcttggtttctctttgtgaagatgaacctagttcttcaggtgaattaaactac
tatgaccttgtcagaactgaaattgcagaagaaagacagtatttacgggaactaaatatg
atcataaaagtgttttgagaagcttttatttctgacagaaagctgtctaaactttctgat
attgaaaagattttcagtaacattttagctatacatgaattgactgtgaaacttttaggt
ttaattgaagacacagttgaaatgactgatgaaagcagccctcatccctcagctggaagc
tgttttgaagatttggcagaggaacaagcatttgatccttacgaaacattatcacagcat
attctttcaccaaaatttaatgaacatttcagtaagttgatggccagacctgcagtggct
ctacccttccagtccattgctgatggttttaaagaggcacttcgttatgtccttccacgc
cttatgctggtgccagtatatcattgttggcactactttgaattattaaagcaattgaaa
gcatgtagtgaagagcatgaagacagagagtgtttgaaccaagctgttactgctctcatg
aatctccaaggtagtgtagaccgaatttacaagcagtattcacctagacgctgacctggg
gatcctgtttgccctttttataatcgtcaattaagaagcaagcacctggctattaaaaaa
atgaatgaaattcagaaaaacatagatggatgggaagacaaagatattggacagtgttgt
aatgaatttattatggaaggcccattgacaagaattggtgctaaacatgaacggcatatt
tttctctttgatggcttaatgattagccacaaacccagtcacagccagtcacaccttcca
ggatacagtagtacagaatacagattaaaagaaaaatttgtcatgagggaaatacaaata
tgtgacaaagaagatacttgtgagtgcaaacatgcttttgaattagtatccaaagatgaa
aacagcataatatttgctgctaagtttgctgaagagaaaaataactggatggcagcactt
atttctcttcattatcatagtactctacatcgaatgctagattcagtattattgaaggaa
gaaaatgagcaaccacttagattaccgagtcctgaagtgtatcgttttgtggtaaaagac
tctgaggaaaacattgtttttgaagacaacttgcaaagtagaagtggaatccccattatt
aaaggaggaactgtggtgaaattaattgaaaggttaacacatcacatgtatgcagatccc
aattttgttcgcacttttcttactacgtatcgttcattttgtaaaccacaggaattgcta
agcttactgattgaacgatttgaaattccagagccagaacctagtgaagcagataaattg
gcagtagagaaaggcgagcagccaatcagtgcagaccttaaaatgtttcgcaaggaatac
gtccagccagtacaacttaggatcttaaatgtgtttcggcacagggttgaacaccatttt
tatgattttgaaagaggcttggagttgcttgaaagactagaatccttcatttcaagtgta
agagggaaaactatgaagaactgggtagagtcagttgctaagatcatcaagaggaagaaa
caagctcaggcaaatggaataagccataatattacctttggaagtccacctccaccaact
gaatggcatatcagcagaccaggacagtttgaaacatttgatctcatgacacttcatcca
atagaaattgcacatcagctgatacttttggaatctgatctctacaggaaagttcaacct
tctgaacttgtagggagtgtatggaccaaagaagataaagaaataaattctccaaattta
ttaaaaatgattcgccacaccacaaatctcactctctggtttgaaaagtgcattgtggaa
gcagaaaattttgaggaacgggtggcagtactaagtagaattatagaaattctgcaagtt
tttcaagatttgaataatttcagtggtgtattagagatcgtcagtgcaataaattcagta
tcagtctgtagactagatcatacctttgaggaaagaaaaaggaaatttttggatgaagct
gtggaattaagtcaagatcattttaaaaaatatctagtgaaatttaagtcaatcagtcca
ccttgtgtgtctttttttggaatatatttaacaaatatattctgaagactgaatataatt
ctgaagactgaagaagggaataatgattttttaaaaaagaaagggaaagatttaatcaat
ttcagtaagaggaaaaaagtagctgaaattaccggagaaattcagcaatatcagaatcag
ccttactgtttacggatagaaccagaaatgaggaggttctttgaaaaccttaaccccatg
ggaaatgcttctgaaaacgagtttacagattatttgttcaacaagtcactagaaattgaa
ccccgaaactgcaaacagccacctcaatttcctaggaaatcaactttctctttaaaatct
cctggaataaggcctaatacaggctgacatggctctacctcaggtactttacgaggtcat
ccaacaccattagaaagagaaccacgtaaaataagctttagtcggattgctgaaacagag
cttgcatcaacagtgtcagcaccaacctctccgaatacaccgtctactccaccagtatct
gcttcttcagaccttagtgtgtttttagatgtggatctcaacagttcctgtggaagcaat
agcatctttgctccagtcctcttgcctcattcaaagtctttctttagttcgtgtggtggt
tttcataaacgaagtgaagggccactgattcctcctccacttcctcctcgaaaaaaattt
gatcatgatgcttcaaattccaaggggactatgaaatctgatgatgacccccctgctatt
ctgccaagacagcctcctcctccaaaggtaaaacccagagttcctgctccttctggtgca
tttgacgggcctctgcatagtccaccaccgccgccgccgagagatgctcttcctgatacc
cctccaccagttccccttcggcctctagaacgctttataaactgtctgtttactcttcag
ccacctgcactgggacatcttcatagagacccagactggttcagagacgttagtacatgt
cccaattctccaaacactcctcctagcacaccctctccaagggtaccacatcgatgctat
gtgctcagttctagtcaaaataatcttgctcatcctcaagcgccccccgttccaccgagg
cagaattcaagccctcacctgccaaaactgccaccaaagacttacaaacgggagctttcg
caccccccattgtgtagactgcctttgctagaaaatgcagaaactcctcaatga

DBGET integrated database retrieval system