KEGG   Orcinus orca (killer whale): 101284956Help
Entry
101284956         CDS       T05247                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00010  Glycolysis / Gluconeogenesis
oor00053  Ascorbate and aldarate metabolism
oor00071  Fatty acid degradation
oor00280  Valine, leucine and isoleucine degradation
oor00310  Lysine degradation
oor00330  Arginine and proline metabolism
oor00340  Histidine metabolism
oor00380  Tryptophan metabolism
oor00410  beta-Alanine metabolism
oor00561  Glycerolipid metabolism
oor00620  Pyruvate metabolism
oor01100  Metabolic pathways
Module
oor_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101284956 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    101284956 (ALDH2)
   00620 Pyruvate metabolism
    101284956 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101284956 (ALDH2)
   00561 Glycerolipid metabolism
    101284956 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101284956 (ALDH2)
   00310 Lysine degradation
    101284956 (ALDH2)
   00330 Arginine and proline metabolism
    101284956 (ALDH2)
   00340 Histidine metabolism
    101284956 (ALDH2)
   00380 Tryptophan metabolism
    101284956 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101284956 (ALDH2)
Enzymes [BR:oor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101284956 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 101284956
NCBI-ProteinID: XP_004281483
LinkDB All DBs
Position
Unknown
AA seq 519 aa AA seqDB search
MLRAVVLAAARPCQGRRLLSAAATPAVPAPNQQPEVFYNKIFINNEWHDSVSKKTFPTIN
PSTGDVICHVAEGDKEDVDRAVKAAQAAFQLGSPWRRMDASKRGWLLNRLADLIERDRTY
LAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDYFSYTRHEPVGV
CGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIV
PGFGPTAGAAVASHEDVDKVAFTGSTEVGHLIQTAAGNSNLKRVTLELGGKSPNIIMSDA
DMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYTEFVERSVARARSRVVGNPFDSRTEQ
GPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEEIF
GPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGA
QSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgcagttgtgctcgccgccgcccggccctgccagggccgccggctgctgtcg
gccgccgccaccccggccgtgccggcccccaaccagcagcccgaggtcttctacaacaag
atcttcataaacaatgagtggcatgattctgtcagcaagaaaactttccccaccatcaat
ccatccactggggatgtcatctgtcatgtagctgaaggggacaaggaagacgtggacagg
gcagtgaaggctgcccaggctgcattccagctgggctcgccctggcgccgcatggatgcg
tccaaaaggggctggctgctgaaccgcctggctgatctgattgagcgggaccggacctac
ctggcagccttggagaccctggacaacggcaagccctacgtcatttcctacctggtggat
ttggacatggttctcaaatgtctccgttactatgcaggctgggctgataagtaccacgga
aaaaccattcccattgatggggactacttcagctacacccgccatgaacctgtgggagtg
tgtgggcagatcatcccgtggaacttcccgctcttgatgcaagcatggaaactgggccca
gccttggcgactggaaacgtggttgtgatgaaggtggctgagcagactccactcactgcc
ctctatgtggccaacttgattaaggaggccggctttcctcctggcgtggtcaatatcgta
cctggatttggccccacggctggggccgccgttgcctctcatgaggatgtggacaaagtg
gccttcacaggctccactgaggttggccacctaatccagactgctgcggggaacagtaac
ctcaagagagtgaccctggagctaggaggaaagagtcccaatatcatcatgtcagatgct
gacatggactgggctgtggagcaggcccacttcgccctgttcttcaaccagggccagtgc
tgctgtgcaggctcccggacctttgtgcaggaggacgtttacaccgagtttgtggagcgg
agtgttgcccgggccaggtctcgtgtggtcgggaacccctttgacagccggactgagcag
gggccgcaggtggatgagactcagtttaagaaggtccttggctacatcaaatctgggaag
gaggagggggcgaagctgctgtgtggtggaggggcggctgctgaccgtggctacttcatc
cagcccaccgtgtttggagacgtgcaggatggcatgaccatcgcaaaggaggagatcttt
gggccagtgatgcagattctgaagttcaagaccatagaggaagtcgttgggagagccaac
aattccaagtacgggctggccgcagctgtcttcacaaaggacttggacaaggccaattat
ctgtcccaagccctccaggctggcaccgtgtgggtcaactgctatgatgtgtttggggcc
cagtcaccgtttggtggctacaagctgtctgggagcggccgggagctgggagagtatggg
ctgcaggcatacactgaagtgaaaactgtcacagtcaaagttcctcagaagaactcataa

DBGET integrated database retrieval system