KEGG   Orcinus orca (killer whale): 101285670
Entry
101285670         CDS       T05247                                 

Gene name
TP53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01522  Endocrine resistance
oor01524  Platinum drug resistance
oor04010  MAPK signaling pathway
oor04071  Sphingolipid signaling pathway
oor04110  Cell cycle
oor04115  p53 signaling pathway
oor04137  Mitophagy - animal
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04211  Longevity regulating pathway
oor04216  Ferroptosis
oor04218  Cellular senescence
oor04310  Wnt signaling pathway
oor04722  Neurotrophin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor05012  Parkinson disease
oor05014  Amyotrophic lateral sclerosis
oor05016  Huntington disease
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05162  Measles
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05168  Herpes simplex virus 1 infection
oor05169  Epstein-Barr virus infection
oor05200  Pathways in cancer
oor05202  Transcriptional misregulation in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05216  Thyroid cancer
oor05217  Basal cell carcinoma
oor05218  Melanoma
oor05219  Bladder cancer
oor05220  Chronic myeloid leukemia
oor05222  Small cell lung cancer
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101285670 (TP53)
   04310 Wnt signaling pathway
    101285670 (TP53)
   04071 Sphingolipid signaling pathway
    101285670 (TP53)
   04151 PI3K-Akt signaling pathway
    101285670 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    101285670 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    101285670 (TP53)
   04210 Apoptosis
    101285670 (TP53)
   04216 Ferroptosis
    101285670 (TP53)
   04115 p53 signaling pathway
    101285670 (TP53)
   04218 Cellular senescence
    101285670 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101285670 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101285670 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    101285670 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101285670 (TP53)
   05202 Transcriptional misregulation in cancer
    101285670 (TP53)
   05206 MicroRNAs in cancer
    101285670 (TP53)
   05205 Proteoglycans in cancer
    101285670 (TP53)
   05203 Viral carcinogenesis
    101285670 (TP53)
   05230 Central carbon metabolism in cancer
    101285670 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101285670 (TP53)
   05212 Pancreatic cancer
    101285670 (TP53)
   05225 Hepatocellular carcinoma
    101285670 (TP53)
   05226 Gastric cancer
    101285670 (TP53)
   05214 Glioma
    101285670 (TP53)
   05216 Thyroid cancer
    101285670 (TP53)
   05220 Chronic myeloid leukemia
    101285670 (TP53)
   05217 Basal cell carcinoma
    101285670 (TP53)
   05218 Melanoma
    101285670 (TP53)
   05219 Bladder cancer
    101285670 (TP53)
   05215 Prostate cancer
    101285670 (TP53)
   05213 Endometrial cancer
    101285670 (TP53)
   05224 Breast cancer
    101285670 (TP53)
   05222 Small cell lung cancer
    101285670 (TP53)
   05223 Non-small cell lung cancer
    101285670 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101285670 (TP53)
   05014 Amyotrophic lateral sclerosis
    101285670 (TP53)
   05016 Huntington disease
    101285670 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101285670 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101285670 (TP53)
   05161 Hepatitis B
    101285670 (TP53)
   05160 Hepatitis C
    101285670 (TP53)
   05162 Measles
    101285670 (TP53)
   05168 Herpes simplex virus 1 infection
    101285670 (TP53)
   05163 Human cytomegalovirus infection
    101285670 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101285670 (TP53)
   05169 Epstein-Barr virus infection
    101285670 (TP53)
   05165 Human papillomavirus infection
    101285670 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101285670 (TP53)
   01522 Endocrine resistance
    101285670 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oor03000]
    101285670 (TP53)
   03036 Chromosome and associated proteins [BR:oor03036]
    101285670 (TP53)
   03400 DNA repair and recombination proteins [BR:oor03400]
    101285670 (TP53)
Transcription factors [BR:oor03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    101285670 (TP53)
Chromosome and associated proteins [BR:oor03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     101285670 (TP53)
DNA repair and recombination proteins [BR:oor03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    101285670 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD TAD2 CEP1-DNA_bind
Other DBs
NCBI-GeneID: 101285670
NCBI-ProteinID: XP_004266944
LinkDB
Position
Unknown
AA seq 387 aa
MEESQAELGVEPPLSQETFSDLWKLLPENNLLSSELSPAVDDLLLSPEDVANWLDERPDE
APQMPEPPAPAAPTPAAPAPATSWPLSSFVPSQKTYPGSYGFRLGFLHSGTAKSVTCTYS
PPLNKLFCQLAKTCPVQLWVSSPPPPGTRVRAMAIYKKSEYMTEVVRRCPHHERCSDYSD
GLAPPQHLIRVEGNLRAEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNFMCNSSCMGGM
NRRPILTIITLEDSNGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGQSCPELPTGSAKR
ALPTGTSSSPPQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGESRAHS
SHLKSKKGPSPSRHKKLMFKREGPDSD
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggaggagtcgcaggcagagctcggcgtggagccccctctgagtcaggagacgttttca
gacttgtggaaactgcttcctgaaaacaaccttctgtcctctgagctctccccagccgtg
gatgacctgctgctgtccccagaagatgtcgcaaactggctggatgaacgtccagatgaa
gccccccaaatgccagagccccctgcgccagctgcccccaccccagccgccccagcacca
gccacctcctggcccctgtcgtcctttgtcccttcccagaagacctaccctggcagctac
gggttccgtctaggtttcctgcattccggaacagccaagtctgtaacctgcacgtattcc
cctcccctcaacaagctgttttgccagctggccaagacctgcccagtgcagctgtgggtc
agctcaccacccccacccggcacccgggtccgcgccatggccatctataagaagtcagag
tacatgacggaggttgtgaggcgctgtccccaccatgagcgctgctctgactatagcgat
ggtctggcccctcctcagcatctcatccgggtggaagggaatttacgtgctgagtatttg
gacgacagaaacacttttcgacacagcgtggtggtgccctacgagccgcctgaggttggc
tctgactgtaccaccatccactacaacttcatgtgtaacagctcctgcatgggaggcatg
aaccggcggcccatcctcaccatcatcacactggaagactcgaatggtaatctgctggga
cggaacagctttgaggtgcgtgtttgtgcctgtcctgggagagaccgccgcacagaggaa
gagaatttccgcaagaaggggcagtcttgccctgagctgcccactgggagcgctaagcga
gcactgcctactggcaccagctcctctccaccgcaaaagaagaaaccactggatggagaa
tatttcactcttcagatccgtgggcgtgaacgctttgagatgttccgagagctgaatgag
gccttggagctgaaggatgctcaggctggaaaggagccaggggaaagcagggctcactct
agccacctgaagtctaagaaggggccgtctccctcccgccataaaaaactgatgttcaag
agagaagggcctgattcagactga

DBGET integrated database retrieval system