KEGG   Orcinus orca (killer whale): 101285951Help
Entry
101285951         CDS       T05247                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00052  Galactose metabolism
oor00500  Starch and sucrose metabolism
oor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101285951 (GANC)
   00500 Starch and sucrose metabolism
    101285951 (GANC)
Enzymes [BR:oor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101285951 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 101285951
NCBI-ProteinID: XP_004274161
LinkDB All DBs
Position
Unknown
AA seq 918 aa AA seqDB search
MDAAEKEEISVEDEAVDKNIFKDCSKIAFYRRQKQRLSKKSTYRALLDSVTEGKESTRFQ
IINEAAKVPLLAEVYGIEGNIFRLKINEETPLKPRYEVPDVLTSKPSTVRLISCSGDTGS
LVLANGKGDLKCHITANPFKIDLVSEEEVVMSINSLGQLYFEQLQIPPKQRATKENEEDT
SDDTTQENQEELGLWEEKFRNFVDVKDNGPASIGLDFSLHGFEHVYGIPQHAESHQLKNT
SDGDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKLGRTLGIFWLNASETLVEINTSGDT
EPAVKDALTQTGPVAVKQKVRSQTDVHWMSESGIIDVFLLTGPTPSDVFKQYSYLTGTQA
MPPLFSLGYHQCRWNYEDEHDVKAVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWDKKRFP
NPKRMQELLRSKKRKLVVISDPHIKIDPDYLVYAKAKEQGFFVRNHEGGDFEGVCWPGLS
SYLDFTSPKVREWYSSLFAFPVYQGSTDILHIWNDMNEPSVFRGPELTMQKNAIHHGNWE
HRELHNIYGFYQQMATAEGLIQRSKGKERPFVLTRSFFAGSQRYGAVWTGDNTAKWSYLK
ISIPMLLTLSVTGISFCGADVGGFIGNPKAELLVRWYQAGAYQPFFRGHATKNTKRREPW
LFGEEHTRLIQEAIRERYTLLPYWYSLFYSAYVASQPVMRPLWVEFPDEVETFGVEDEYM
LGSALLVHPVTEPKATVVDVFLPGSSEVWYDSKTFAHWEGACTVKIPVALDTIPVFQRGG
SVVPIKTTIGRSTGCMTDSPYGLWVALSTKGSAVGEFYLDDGHSFQYLHQKQFLHRKFSF
ASGVLINSCADKRGHYPSKCVVEQILVLGLKKQPSSVTSHSPDGKAQPVAFTYCAKTSTL
NLEKFSLNIGADWKVQIQ
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggacgcagctgagaaagaggaaatcagtgttgaagatgaagctgtggataaaaacatt
ttcaaagactgcagcaagattgctttctacaggcgtcagaaacagcggctctccaagaag
tctacctatcgggcattactagactcagtcacagaaggcaaagagagcaccaggttccaa
atcatcaacgaagcagctaaggttcctctcctggctgaagtttatggtatagagggaaat
attttcaggcttaaaatcaatgaagaaacacccttgaaacccaggtatgaagttcctgat
gtcctcacaagcaagccaagcactgtaaggctgatttcatgctcaggggatacaggcagt
cttgtattggcaaatggaaaaggagatctgaagtgtcacatcacagcaaacccattcaag
atagacttggtatctgaagaagaggttgtgatgagcataaactccctgggccaattgtac
tttgagcagctgcagattcctcccaagcaaagagccaccaaggaaaatgaggaggataca
tcagatgataccactcaggaaaatcaagaggaactgggcctgtgggaggagaaattcaga
aattttgtggatgtcaaagataatggtcctgcctccattggtttggatttctccttgcat
gggtttgagcatgtctatgggatcccgcaacatgcagaatcacaccaacttaaaaatacc
agtgatggagatgcttaccgtctttataacctagatgtctatggatataaaatacatgac
aaaatgggcatttatggttcagtgccttatctcctggcccacaaactgggcaggactcta
ggcattttttggctaaatgcctcagaaacactagtggagatcaacactagtggagataca
gagcctgctgtaaaggatgcattgacccagacgggcccagttgctgttaaacaaaaggtc
agatctcaaactgatgtgcactggatgtcagagagtggaatcattgatgtttttttgctg
acaggacctacaccttctgacgtcttcaagcagtactcataccttacaggcacacaagcc
atgccccctctcttctccttggggtaccatcagtgccgctggaactacgaagatgagcat
gatgtaaaggcagtggatgcaggatttgatgaacatgacattccttacgatgtcatgtgg
ctggacatagagcacactgaaggcaagaggtacttcacctgggacaagaaaaggttccca
aaccccaaaaggatgcaagagctgctcaggagcaaaaaacgtaagcttgtggtcattagt
gacccccacatcaagattgatcccgactacttagtgtatgctaaggccaaagaacagggc
ttctttgtgaggaatcatgaagggggagactttgaaggtgtatgctggcctggtctctcc
tcttacctggattttaccagtcccaaagtcagagagtggtattccagtctttttgctttc
cctgtttatcagggatctactgacatcctccacatatggaacgacatgaatgagccctct
gtctttagagggccagaactaaccatgcagaagaatgccattcatcatggcaactgggag
caccgagaacttcacaacatctatggcttttatcagcaaatggccactgcagaaggactg
atccaacgatctaaagggaaggagagaccctttgttcttacacgttctttctttgctgga
tcacaaagatatggtgctgtgtggacaggtgacaacacagcaaagtggagttacctgaaa
atttctatccctatgttactcaccctcagcgtgactgggatctctttttgtggagcggat
gtaggcggcttcatcgggaatccaaaggcagagctgctagtgcggtggtaccaggctgga
gcctaccaacccttcttccgtggccatgccaccaagaacaccaagcgacgggaaccctgg
ctctttggggaggagcacacccggctcatccaagaagccatcagagagcgctacaccctc
ctgccctactggtattctctgttctactctgcatacgtggcttcccaacccgtcatgagg
cctctgtgggtagagttccctgatgaagtagagactttcggtgtggaagatgaatacatg
ctgggaagcgctttattggttcacccagtcacagaaccaaaagctactgtggttgatgtg
tttctgccaggatcaagtgaggtctggtatgactctaagacatttgctcattgggaagga
gcatgtactgtaaagatcccagtagccttggacacgataccagtgtttcaacgaggtgga
agtgtggtaccaataaagacaactataggaagatccacgggctgcatgactgattcccca
tatggactctgggtggccctaagcactaagggttctgctgtgggtgaattctatctcgat
gatggtcattcattccaatacctccaccagaagcaattcttgcacaggaagttttcattc
gcctcaggtgttttgatcaacagttgtgctgacaagaggggtcattatcccagcaagtgt
gtggtggagcagatcttggtcctaggcctcaagaagcagccatcttctgtgaccagccac
tcacctgatggtaaagctcagcctgtggcttttacatattgtgccaaaacatccaccctg
aacctggagaagttctcactgaacattggtgctgactggaaggtccaaatccagtga

DBGET integrated database retrieval system