KEGG   Orcinus orca (killer whale): 101285957Help
Entry
101285957         CDS       T05247                                 

Gene name
COLGALT2
Definition
(RefSeq) procollagen galactosyltransferase 2 isoform X1
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00310  Lysine degradation
oor00514  Other types of O-glycan biosynthesis
oor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101285957 (COLGALT2)
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    101285957 (COLGALT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:oor01003]
    101285957 (COLGALT2)
Enzymes [BR:oor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     101285957 (COLGALT2)
Glycosyltransferases [BR:oor01003]
 O-Glycan biosynthesis
  O-linked Gal type
   101285957 (COLGALT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Aminotran_4
Motif
Other DBs
NCBI-GeneID: 101285957
NCBI-ProteinID: XP_004275268
LinkDB All DBs
Position
Unknown
AA seq 506 aa AA seqDB search
MDEPESYPDEIGPKHWPGSRFAHVMKLRQAALRTAREKWSDYILFIDVDNFLTNPQTLNL
LIAENKTVVAPMLESRGLYSNFWCGITPQGFYKRTPDYLQIREWKRLGCFPVPMVHSTFL
IDLRKEASDKLVFYPPHQDYTWTFDDIIVFAFSSRQAGIQMHLCNREHYGYLPIPLKPHQ
TLQEDIENLIHVQIEAMIDHPPMEPSQFVSVVPKYPDKMGFNEIFMINLKRRKDRRDRML
RTLYEQEIEVKIVEAVDGKALNTSQLKALNIEMLPGYRDPYSSRPLTRGEIGCFLSHYSV
WKEVIDRELEKTLVIEDDVRFEHQFKKKLMKLMDDIDRVQLDWELIYIGRKRMQLKEPEK
AVPNVVNLVEADYSYWTLGYVISLEGAQKLVGANPFGKMLPVDEFLPIMYNKHPVAEYME
HYESRDLKAFSAEPLLIYPTHYTGQPGYLSDTETSTIWDNETVATDWDRTHAWKSRKQGH
IYRNAKNTEALPPPTSLDTVPSRDEL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacctgagtcttatcctgatgaaattggaccaaagcactggcctggctcccgt
tttgcccatgtgatgaaactacgacaggcagcccttcgaactgcgagggaaaaatggtca
gactacattctgttcatagatgttgacaacttcctgactaatccacagaccctcaatcta
ctgattgcagaaaacaaaaccgttgtggcccccatgctggagtctcggggcctgtactct
aatttctggtgcggaatcacacctcagggcttctataaacggaccccagactatcttcag
attagagaatggaagaggttgggctgctttccagtccccatggtccactccacattccta
attgacctcaggaaggaagcctctgacaagctggtgttctaccctccgcaccaggactac
acctggacatttgatgacatcattgtctttgccttctccagcaggcaagcaggcatccag
atgcacctctgcaacagagagcactacggctacctgcccatccccctgaagccccatcag
accctacaggaggacattgagaacctcatccatgtgcagatagaagcaatgattgaccat
cctccaatggaaccttcccagttcgtctcagttgtccctaaatatccagacaagatggga
ttcaatgagattttcatgataaacctgaagcgtagaaaggacagacgggaccggatgtta
cgtaccctgtacgagcaggagattgaagtcaagattgtcgaggctgtggatggaaaggca
ctcaacacaagccagctgaaggccctgaatattgaaatgctgccaggatatcgagatccc
tactcctccaggcctctaactaggggtgaaattggctgcttccttagccactactctgtc
tggaaagaggtaattgaccgagagctggagaagactctcgttattgaggatgatgtgcgt
tttgaacatcagtttaagaagaagctcatgaagctgatggatgatattgatcgagtccag
ctggattgggaactgatttatattggcaggaagaggatgcaactaaaagagccagagaaa
gctgtgcccaatgtggtaaatctggtcgaagctgactattcttactggactctgggctat
gtcatctctctggaaggagcacagaagcttgttggagccaatccttttgggaagatgcta
ccagtggatgagtttctgccaatcatgtacaacaagcatcctgttgctgagtacatggag
cattacgaatccagggacttgaaagccttctctgcagaacccttgctcatctacccaaca
cactacacaggccagccagggtatctgagtgacacggagacctcaaccatctgggacaat
gagacagtggccactgactgggacaggacacatgcctggaagtccaggaagcaaggtcac
atctaccgcaatgccaagaacacagaggccctgccaccgccaacctccctggacactgtg
ccttcgagagatgagttatga

DBGET integrated database retrieval system