KEGG   Orcinus orca (killer whale): 101286234
Entry
101286234         CDS       T05247                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01522  Endocrine resistance
oor01524  Platinum drug resistance
oor04068  FoxO signaling pathway
oor04110  Cell cycle
oor04115  p53 signaling pathway
oor04120  Ubiquitin mediated proteolysis
oor04144  Endocytosis
oor04151  PI3K-Akt signaling pathway
oor04218  Cellular senescence
oor04625  C-type lectin receptor signaling pathway
oor04919  Thyroid hormone signaling pathway
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05169  Epstein-Barr virus infection
oor05200  Pathways in cancer
oor05202  Transcriptional misregulation in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05218  Melanoma
oor05219  Bladder cancer
oor05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:oor00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101286234 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101286234 (MDM2)
   04151 PI3K-Akt signaling pathway
    101286234 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101286234 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    101286234 (MDM2)
   04115 p53 signaling pathway
    101286234 (MDM2)
   04218 Cellular senescence
    101286234 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101286234 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101286234 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101286234 (MDM2)
   05202 Transcriptional misregulation in cancer
    101286234 (MDM2)
   05206 MicroRNAs in cancer
    101286234 (MDM2)
   05205 Proteoglycans in cancer
    101286234 (MDM2)
   05203 Viral carcinogenesis
    101286234 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    101286234 (MDM2)
   05220 Chronic myeloid leukemia
    101286234 (MDM2)
   05218 Melanoma
    101286234 (MDM2)
   05219 Bladder cancer
    101286234 (MDM2)
   05215 Prostate cancer
    101286234 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101286234 (MDM2)
   05169 Epstein-Barr virus infection
    101286234 (MDM2)
   05165 Human papillomavirus infection
    101286234 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101286234 (MDM2)
   01522 Endocrine resistance
    101286234 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oor04131]
    101286234 (MDM2)
   04121 Ubiquitin system [BR:oor04121]
    101286234 (MDM2)
Enzymes [BR:oor01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101286234 (MDM2)
Membrane trafficking [BR:oor04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101286234 (MDM2)
Ubiquitin system [BR:oor04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    101286234 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 101286234
NCBI-ProteinID: XP_012392920
LinkDB
Position
Unknown
AA seq 491 aa
MCNTNMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVIVNQQEPSDSGT
SVSENRCHLEGGSVQKDLVQELQEEKPSSSDLVSRPSTSSRRRAVSETEENSDELPGERQ
RKRHKSDNISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCSEMNPPLPPHCNRCWALRENWLPEDKGKDKGKMSEKAKLENSAQVEEGFDVP
DCKKSTVNDSKESCVEENDDKITQASLSQESEDYSQPSTSNSIIYSSQEDVKELEREETQ
DKEESVESSFPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctactgatggtgctgtaagcacctcacagattcca
gcttcggaacaagagaccctggttagaccaaagccattgcttttgaagttgttgaagtct
gttggtgcacagaaggacacctatactatgaaagaggttatattttatcttggccagtat
attatgactaaacgattatatgatgagaaacaacagcatattgtgtattgttcaaatgat
cttctaggggatttgtttggagtgccaagcttctctgtgaaagagcacaggaaaatatat
acaatgatttatagaaacttggtgatagtcaatcagcaggaaccatcagattcaggcaca
tctgtgagtgaaaacaggtgtcaccttgaaggtgggagtgttcaaaaggaccttgtgcaa
gagctacaggaagagaaaccttcatcttcagatttggtttctagaccatctacctcatct
agaaggagagcagttagtgagacagaagaaaattcagatgaattacctggtgaacgacaa
agaaagcgccacaaatctgataatatttccctttcctttgatgaaagccttgctctgtgt
gtaataagggagatatgttgtgaaagaagcagtagcagtgaatcgacagggactccatca
aatccggatcttgatgctggtgtaagtgaacattcaggtgattggttggatcaggattca
gtttcagatcaattcagtgtagaatttgaagttgagtctctggattcagaagattatagc
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcgagttactgtg
tatcaggcaggggagagtgatacagattcatttgaagaagatcctgaaatttccttagct
gactattggaagtgtacttcatgcagtgaaatgaatcctccccttccacctcattgcaac
agatgttgggcccttcgtgaaaattggcttcctgaagataaagggaaagataaagggaaa
atgtctgagaaagccaaactagaaaactcagcacaagtagaagagggctttgatgtccct
gactgtaagaaatctacagtgaatgattccaaagaatcatgtgttgaggaaaatgatgat
aagatcacacaagcctccctatcccaagaaagtgaggactattctcagccatcaacttct
aatagtatcatttatagcagccaagaagatgtcaaagagttggagagggaagaaacacaa
gacaaagaagaaagtgtggaatctagttttcctcttaatgccattgaaccttgtgtgatt
tgccaaggtcgacctaaaaatggttgcatagtccatggcaaaacaggacatcttatggca
tgctttacatgtgccaagaagctaaagaaaaggaataagccctgccccgtatgcagacaa
ccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system