KEGG   Orcinus orca (killer whale): 101286283Help
Entry
101286283         CDS       T05247                                 

Gene name
BCAR1
Definition
(RefSeq) breast cancer anti-estrogen resistance protein 1 isoform X1
  KO
K05726  breast cancer anti-estrogen resistance 1
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04015  Rap1 signaling pathway
oor04062  Chemokine signaling pathway
oor04510  Focal adhesion
oor04670  Leukocyte transendothelial migration
oor04810  Regulation of actin cytoskeleton
oor04935  Growth hormone synthesis, secretion and action
oor05100  Bacterial invasion of epithelial cells
oor05135  Yersinia infection
oor05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101286283 (BCAR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101286283 (BCAR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101286283 (BCAR1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101286283 (BCAR1)
   04062 Chemokine signaling pathway
    101286283 (BCAR1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    101286283 (BCAR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101286283 (BCAR1)
   05100 Bacterial invasion of epithelial cells
    101286283 (BCAR1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101286283 (BCAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAS_C Serine_rich SH3_1 SH3_9 SH3_2
Motif
Other DBs
NCBI-GeneID: 101286283
NCBI-ProteinID: XP_004273327
LinkDB All DBs
Position
Unknown
AA seq 867 aa AA seqDB search
MNYLNVLAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRL
KILVGMHDKKPVGPGPGPPASSALPQPSLHPPAAQYTPMLPATYQPQPDSVYLVPTPSKT
QQGLYQAPGPSPQFQSPPAKQTATFSKQMPHHPFPSPAPDLYQVPPGPGSPAQDIYQVPP
SAGIGHDIYQVPPSMDARSWEGTKPPAKVAVSTRVGQGYVFEAPQPEQDEYDIPRHLLAA
GPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPSLDVYDVPPSVEKGLPPSSHH
AVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPTRHPLVLAAPPPDSPPAEDVYD
VPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEAANGSVADDGVYAVPPPAEREAPAD
TKRLSASSTGSTRSSQSASSLEAAVPGREPLELEVAVEALARLQQGVSATVAHLLDLAGS
AGGCGGWRSTSEPQEPPAQDLRAAVAAVHGAVHELLEFARSAVGNAAHTSDRTLHAKLSR
QLQKMEDVYQTLVAHGQALDSSRGGLGATPEDLDRLVACSRAVPEDVKQLASFLHGNASL
LFRRTKASVPGPEGGGPLHLNPIDKASSIQSRPLPSPPKFTSQDSPDGQYENSEGGWMED
YDYVHLQGKEEFEKTQKELLEKGNIMRQGKGQLELQQLKQFERLEQEVSRPIDHDLANWM
PAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSK
FVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPAAA
QDMVDRVKELGHSTQQFRRVLGQLAAA
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgaactacctgaacgtgctggccaaagccctctacgacaatgtggccgagtccccagat
gagctctccttccgcaagggcgacatcatgacggtgctagagcgggacacgcagggccta
gatggctggtggctctgctcgctgcacgggcgccaaggcatcgtgcccgggaaccgcctc
aagatcctggtgggcatgcatgacaagaagcccgtggggcccggccccggcccgcccgcc
agctcggccctgcctcagcccagcctccaccccccggcagcccagtacacacccatgctg
cctgccacgtaccagccccagccggacagtgtctacctggtgcccacccccagcaagact
cagcaaggcctctaccaagcccctgggcccagcccccagttccagtctcccccggccaag
cagacagccacattctccaagcagatgccccatcacccgtttcccagccccgccccagac
ctttaccaggtgcccccggggcctggcagccctgcccaggacatctaccaggtgccgcct
tccgctgggataggacacgacatctaccaggtccccccatccatggatgcacggagctgg
gaggggacgaagccaccagccaaggtggcggtgtccacccgcgtggggcaaggctatgtg
ttcgaggccccccagcccgagcaggacgagtacgacatcccacgccacctgctggccgcg
gggccccaggacatctacgacgtgccccctgttcgggggctgcttcccagccagtacggc
caggaggtatatgacacgccccccatggctgtcaagggtcccaatggccgggacccatcg
ctggacgtgtatgatgtgccccccagtgtggagaagggcctgccgccgtccagccatcat
gcggtgtacgatgttcctccatcggtgagcaaagacgtgcccgacggcccactgctgcgt
gaggagacctatgacgtgccccccgccttcgccaaggccaagccctttgacccgacccgc
cacccgctggtgctcgccgcaccccctccggactcgccaccagctgaggacgtgtatgac
gtgccgcccccggctcctgacctctacgacgtgccccccggtttgcggcggcctggcccg
ggcaccctctacgacgtgccccgagagcgggtccttcctcccgaggcagccaacggcagc
gtggccgacgacggtgtgtacgcggtgcccccccctgccgagcgagaggccccggccgac
accaagcgcctgtcagcctccagcacgggcagcacacgcagcagccagtcggcctcctcc
ctggaggcagcggtgccgggccgtgagcccctggagctggaggtggccgtggaggccctg
gcacggctacagcagggcgtgagcgccaccgtggcccacctcttggacctggcaggcagt
gcgggcgggtgtgggggctggcgcagcacctctgagcctcaggagcctccggcgcaggac
ctgcgggctgccgtggccgccgtccacggggccgtccacgagctgctggagtttgcccgc
agcgccgtgggcaatgccgcccacacttccgaccgcacgctgcatgccaagcttagccgg
caactgcagaagatggaggacgtgtaccagacgctggtggcccacggtcaggcccttgac
agtagccggggaggcctgggggccactcccgaagacctggaccgcctggtggcctgctcg
cgggctgtgcccgaggatgtcaagcagctggcctccttcttgcatggcaacgcctcgctg
ctcttcagacggaccaaggcctctgtcccagggcctgaggggggtggccccctgcacctc
aaccccatcgacaaggccagcagcatccagtcccggcccctgccctcaccccccaagttc
acctcccaggactcgcctgatgggcagtacgagaacagtgagggaggctggatggaggat
tacgactacgtccacctgcaggggaaggaagagtttgagaagacccagaaggagttgctg
gaaaagggcaacataatgcggcaggggaagggccagctggaactgcagcagctgaagcag
tttgaacggctggagcaggaggtgtcacggcccatagaccatgacctggccaactggatg
ccagcccagcccctggccccgggccggacgggcggcctggggccctcggaccggcagctg
ctgctcttctacctggagcagtgcgaggcgaacctgaccacgctcaccaacgctgtggat
gccttcttcaccgctgtggccaccaaccagccccccaaaatcttcgtggcacacagcaag
tttgtcatcctcagcgcccacaagctggtattcatcggggacacactgtcacggcaggct
aaggcggccgacgtccgcagccaggtgacccactacagcaacctgctgtgtgacctcctg
cgcggcatcgtggccaccaccaaggccgctgccctccagtacccgtcgcctgccgccgcc
caggacatggtggacagggtcaaggagctgggccacagcacccagcagttccgccgggtc
ctgggccagctggcagctgcctga

DBGET integrated database retrieval system