KEGG   Orcinus orca (killer whale): 101286388
Entry
101286388         CDS       T05247                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1 isoform X2
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04062  Chemokine signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04114  Oocyte meiosis
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04218  Cellular senescence
oor04270  Vascular smooth muscle contraction
oor04370  VEGF signaling pathway
oor04371  Apelin signaling pathway
oor04380  Osteoclast differentiation
oor04510  Focal adhesion
oor04540  Gap junction
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04613  Neutrophil extracellular trap formation
oor04620  Toll-like receptor signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04666  Fc gamma R-mediated phagocytosis
oor04668  TNF signaling pathway
oor04720  Long-term potentiation
oor04722  Neurotrophin signaling pathway
oor04725  Cholinergic synapse
oor04726  Serotonergic synapse
oor04730  Long-term depression
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04912  GnRH signaling pathway
oor04914  Progesterone-mediated oocyte maturation
oor04915  Estrogen signaling pathway
oor04916  Melanogenesis
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04921  Oxytocin signaling pathway
oor04926  Relaxin signaling pathway
oor04928  Parathyroid hormone synthesis, secretion and action
oor04929  GnRH secretion
oor04934  Cushing syndrome
oor04935  Growth hormone synthesis, secretion and action
oor05010  Alzheimer disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05034  Alcoholism
oor05132  Salmonella infection
oor05135  Yersinia infection
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05216  Thyroid cancer
oor05218  Melanoma
oor05219  Bladder cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101286388 (MAP2K1)
   04012 ErbB signaling pathway
    101286388 (MAP2K1)
   04014 Ras signaling pathway
    101286388 (MAP2K1)
   04015 Rap1 signaling pathway
    101286388 (MAP2K1)
   04370 VEGF signaling pathway
    101286388 (MAP2K1)
   04371 Apelin signaling pathway
    101286388 (MAP2K1)
   04668 TNF signaling pathway
    101286388 (MAP2K1)
   04066 HIF-1 signaling pathway
    101286388 (MAP2K1)
   04068 FoxO signaling pathway
    101286388 (MAP2K1)
   04072 Phospholipase D signaling pathway
    101286388 (MAP2K1)
   04071 Sphingolipid signaling pathway
    101286388 (MAP2K1)
   04024 cAMP signaling pathway
    101286388 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    101286388 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    101286388 (MAP2K1)
   04150 mTOR signaling pathway
    101286388 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101286388 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101286388 (MAP2K1)
   04210 Apoptosis
    101286388 (MAP2K1)
   04218 Cellular senescence
    101286388 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101286388 (MAP2K1)
   04540 Gap junction
    101286388 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101286388 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101286388 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101286388 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    101286388 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    101286388 (MAP2K1)
   04660 T cell receptor signaling pathway
    101286388 (MAP2K1)
   04662 B cell receptor signaling pathway
    101286388 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    101286388 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    101286388 (MAP2K1)
   04062 Chemokine signaling pathway
    101286388 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101286388 (MAP2K1)
   04929 GnRH secretion
    101286388 (MAP2K1)
   04912 GnRH signaling pathway
    101286388 (MAP2K1)
   04915 Estrogen signaling pathway
    101286388 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    101286388 (MAP2K1)
   04917 Prolactin signaling pathway
    101286388 (MAP2K1)
   04921 Oxytocin signaling pathway
    101286388 (MAP2K1)
   04926 Relaxin signaling pathway
    101286388 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    101286388 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    101286388 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    101286388 (MAP2K1)
   04916 Melanogenesis
    101286388 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101286388 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    101286388 (MAP2K1)
   04726 Serotonergic synapse
    101286388 (MAP2K1)
   04720 Long-term potentiation
    101286388 (MAP2K1)
   04730 Long-term depression
    101286388 (MAP2K1)
   04722 Neurotrophin signaling pathway
    101286388 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101286388 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101286388 (MAP2K1)
   05206 MicroRNAs in cancer
    101286388 (MAP2K1)
   05205 Proteoglycans in cancer
    101286388 (MAP2K1)
   05230 Central carbon metabolism in cancer
    101286388 (MAP2K1)
   05231 Choline metabolism in cancer
    101286388 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101286388 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101286388 (MAP2K1)
   05212 Pancreatic cancer
    101286388 (MAP2K1)
   05225 Hepatocellular carcinoma
    101286388 (MAP2K1)
   05226 Gastric cancer
    101286388 (MAP2K1)
   05214 Glioma
    101286388 (MAP2K1)
   05216 Thyroid cancer
    101286388 (MAP2K1)
   05221 Acute myeloid leukemia
    101286388 (MAP2K1)
   05220 Chronic myeloid leukemia
    101286388 (MAP2K1)
   05218 Melanoma
    101286388 (MAP2K1)
   05211 Renal cell carcinoma
    101286388 (MAP2K1)
   05219 Bladder cancer
    101286388 (MAP2K1)
   05215 Prostate cancer
    101286388 (MAP2K1)
   05213 Endometrial cancer
    101286388 (MAP2K1)
   05224 Breast cancer
    101286388 (MAP2K1)
   05223 Non-small cell lung cancer
    101286388 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101286388 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    101286388 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    101286388 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101286388 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101286388 (MAP2K1)
   05135 Yersinia infection
    101286388 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101286388 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    101286388 (MAP2K1)
   05161 Hepatitis B
    101286388 (MAP2K1)
   05160 Hepatitis C
    101286388 (MAP2K1)
   05164 Influenza A
    101286388 (MAP2K1)
   05163 Human cytomegalovirus infection
    101286388 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101286388 (MAP2K1)
   05165 Human papillomavirus infection
    101286388 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101286388 (MAP2K1)
   01522 Endocrine resistance
    101286388 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101286388 (MAP2K1)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101286388 (MAP2K1)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: STE group
  STE7 family
   101286388 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Seadorna_VP7 Kinase-like NAD_binding_6
Other DBs
NCBI-GeneID: 101286388
NCBI-ProteinID: XP_004276266
LinkDB
Position
Unknown
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAIGRYPIPPPDAKELELVFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHVAGI
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgacggctccgcggtt
aacgggaccagctcggcggagaccaacctggaggccttgcaaaagaagctggaggagctg
gagcttgatgaacagcaacggaagcgccttgaggccttccttacccagaagcagaaggtg
ggagaactgaaggatgacgactttgagaagatcagtgagctgggtgctggcaatggaggt
gtggtgttcaaggtctcccacaagccgtccggtctggttatggccagaaagctaattcac
ctggagatcaaacctgcaatccggaaccagatcatacgggagctgcaggttctacatgag
tgcaactccccttacattgtgggcttctacggtgcattctacagtgatggcgagatcagt
atctgcatggagcacatggatgggggttccttggatcaagtcctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtaataaaaggcctgacatacctg
agggagaagcacaagattatgcacagagatgtcaagccttccaacatcctagtgaactcc
cgtggggagatcaagctctgtgactttggggtcagcgggcagctcattgactccatggcc
aactccttcgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcattac
tcggtgcagtcggacatctggagcatggggctctctctggttgagatggcgatcgggagg
tatcccatccctcctccagatgccaaggagctggagctggtgtttgggtgccaggtggag
ggagatgcggctgagacaccgccccggccaaggactcccggaaggcccctcagctcttat
ggaatggacagccgacctcccatggcaatttttgagttgttggattacatagtcaatgag
cctcctccaaaattgcccagtggagtattcagtctggaatttcaagattttgtgaataaa
tgcttaataaaaaaccctgcagagagagcagatttgaagcaactcatggttcatgctttt
atcaagagatctgatgctgaggaagtggattttgcaggttggctctgctccaccatcggc
cttaaccagcccagcacacccacccacgtggctggcatctaa

KEGG   Orcinus orca (killer whale): 101287162
Entry
101287162         CDS       T05247                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01521  EGFR tyrosine kinase inhibitor resistance
oor01522  Endocrine resistance
oor04010  MAPK signaling pathway
oor04012  ErbB signaling pathway
oor04014  Ras signaling pathway
oor04015  Rap1 signaling pathway
oor04022  cGMP-PKG signaling pathway
oor04024  cAMP signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04071  Sphingolipid signaling pathway
oor04072  Phospholipase D signaling pathway
oor04140  Autophagy - animal
oor04150  mTOR signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04218  Cellular senescence
oor04270  Vascular smooth muscle contraction
oor04370  VEGF signaling pathway
oor04371  Apelin signaling pathway
oor04540  Gap junction
oor04550  Signaling pathways regulating pluripotency of stem cells
oor04613  Neutrophil extracellular trap formation
oor04620  Toll-like receptor signaling pathway
oor04650  Natural killer cell mediated cytotoxicity
oor04660  T cell receptor signaling pathway
oor04662  B cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04720  Long-term potentiation
oor04722  Neurotrophin signaling pathway
oor04730  Long-term depression
oor04810  Regulation of actin cytoskeleton
oor04910  Insulin signaling pathway
oor04912  GnRH signaling pathway
oor04915  Estrogen signaling pathway
oor04916  Melanogenesis
oor04917  Prolactin signaling pathway
oor04919  Thyroid hormone signaling pathway
oor04921  Oxytocin signaling pathway
oor04926  Relaxin signaling pathway
oor04929  GnRH secretion
oor04934  Cushing syndrome
oor04935  Growth hormone synthesis, secretion and action
oor05010  Alzheimer disease
oor05022  Pathways of neurodegeneration - multiple diseases
oor05132  Salmonella infection
oor05135  Yersinia infection
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05216  Thyroid cancer
oor05218  Melanoma
oor05219  Bladder cancer
oor05220  Chronic myeloid leukemia
oor05221  Acute myeloid leukemia
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
oor05230  Central carbon metabolism in cancer
oor05231  Choline metabolism in cancer
oor05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101287162 (MAP2K2)
   04012 ErbB signaling pathway
    101287162 (MAP2K2)
   04014 Ras signaling pathway
    101287162 (MAP2K2)
   04015 Rap1 signaling pathway
    101287162 (MAP2K2)
   04370 VEGF signaling pathway
    101287162 (MAP2K2)
   04371 Apelin signaling pathway
    101287162 (MAP2K2)
   04066 HIF-1 signaling pathway
    101287162 (MAP2K2)
   04068 FoxO signaling pathway
    101287162 (MAP2K2)
   04072 Phospholipase D signaling pathway
    101287162 (MAP2K2)
   04071 Sphingolipid signaling pathway
    101287162 (MAP2K2)
   04024 cAMP signaling pathway
    101287162 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    101287162 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    101287162 (MAP2K2)
   04150 mTOR signaling pathway
    101287162 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101287162 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    101287162 (MAP2K2)
   04218 Cellular senescence
    101287162 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101287162 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101287162 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101287162 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101287162 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    101287162 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    101287162 (MAP2K2)
   04660 T cell receptor signaling pathway
    101287162 (MAP2K2)
   04662 B cell receptor signaling pathway
    101287162 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    101287162 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101287162 (MAP2K2)
   04929 GnRH secretion
    101287162 (MAP2K2)
   04912 GnRH signaling pathway
    101287162 (MAP2K2)
   04915 Estrogen signaling pathway
    101287162 (MAP2K2)
   04917 Prolactin signaling pathway
    101287162 (MAP2K2)
   04921 Oxytocin signaling pathway
    101287162 (MAP2K2)
   04926 Relaxin signaling pathway
    101287162 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    101287162 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    101287162 (MAP2K2)
   04916 Melanogenesis
    101287162 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101287162 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    101287162 (MAP2K2)
   04730 Long-term depression
    101287162 (MAP2K2)
   04722 Neurotrophin signaling pathway
    101287162 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101287162 (MAP2K2)
   05206 MicroRNAs in cancer
    101287162 (MAP2K2)
   05205 Proteoglycans in cancer
    101287162 (MAP2K2)
   05230 Central carbon metabolism in cancer
    101287162 (MAP2K2)
   05231 Choline metabolism in cancer
    101287162 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101287162 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101287162 (MAP2K2)
   05225 Hepatocellular carcinoma
    101287162 (MAP2K2)
   05226 Gastric cancer
    101287162 (MAP2K2)
   05214 Glioma
    101287162 (MAP2K2)
   05216 Thyroid cancer
    101287162 (MAP2K2)
   05221 Acute myeloid leukemia
    101287162 (MAP2K2)
   05220 Chronic myeloid leukemia
    101287162 (MAP2K2)
   05218 Melanoma
    101287162 (MAP2K2)
   05211 Renal cell carcinoma
    101287162 (MAP2K2)
   05219 Bladder cancer
    101287162 (MAP2K2)
   05215 Prostate cancer
    101287162 (MAP2K2)
   05213 Endometrial cancer
    101287162 (MAP2K2)
   05224 Breast cancer
    101287162 (MAP2K2)
   05223 Non-small cell lung cancer
    101287162 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101287162 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    101287162 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101287162 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101287162 (MAP2K2)
   05135 Yersinia infection
    101287162 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101287162 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    101287162 (MAP2K2)
   05161 Hepatitis B
    101287162 (MAP2K2)
   05160 Hepatitis C
    101287162 (MAP2K2)
   05164 Influenza A
    101287162 (MAP2K2)
   05163 Human cytomegalovirus infection
    101287162 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101287162 (MAP2K2)
   05165 Human papillomavirus infection
    101287162 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101287162 (MAP2K2)
   01522 Endocrine resistance
    101287162 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101287162 (MAP2K2)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101287162 (MAP2K2)
Protein kinases [BR:oor01001]
 Serine/threonine kinases: STE group
  STE7 family
   101287162 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo CAMSAP_CC1
Other DBs
NCBI-GeneID: 101287162
NCBI-ProteinID: XP_004277258
LinkDB
Position
Unknown
AA seq 400 aa
MLARRKPVLPALTINPAIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPMVDGAEGEPHSISPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGIFTQDFQEFVNKCLIKNPAERADL
KMLMNHAFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccccgccatcgccgag
ggcccgtcccccaccagcgagggcgcctccgaagcaaacttggtggacctgcagaagaag
ctagaggagctagaacttgacgagcagcagaagaagcggctggaagccttcctcacccag
aaggccaaggtcggggagctcaaggacgatgactttgaaaggatctcggagctgggagcc
gggaacggtggggtggtcaccaaggtccagcacagaccctcgggcctcatcatggcaaga
aagctgatccacctggagatcaagccagccatccggaaccagatcatccgtgagctgcag
gtgctgcatgagtgtaactccccgtacatcgtgggcttctatggggccttctacagcgac
ggcgagatcagcatctgcatggagcacatggacggtggctccctggaccaggtgttgaaa
gaagccaagaggatccccgaagagatcctggggaaggtcagcatcgcggttctgcggggc
ctggcgtatctccgggagaagcaccagatcatgcaccgagatgtgaagccatccaacatc
ctcgtcaactcccgaggggagatcaagctgtgcgactttggggtgagcgggcagctcatc
gactccatggccaactccttcgtgggcacgcggtcctacatgtctccggagcggctgcaa
ggcactcactactcggtgcagtcagacatctggagcatgggcctgtccctggtggagctg
tccattggaaggtaccccatccccccgccggacgccaaggagctggaggccatatttggc
cggcccatggttgacggcgcggaaggagagcctcacagcatctcgccgcggccgagaccc
cccggacgccccatcagcggtcatgggatggacagccgaccggcaatggcaatctttgag
ctgctggactacatcgtgaacgagcctcctcccaagctgcccaacggcatcttcacccag
gacttccaggagtttgtaaataaatgcctaattaagaacccagcagagcgagcagatctg
aagatgctcatgaaccacgccttcatcaagcggtccgaggtggaagaagtggattttgcc
ggctggttgtgtaaaacgctgcggctgaaccagcccagcacgcccacgcgcactgccgtc
tga

DBGET integrated database retrieval system