KEGG   Orcinus orca (killer whale): 101286839Help
Entry
101286839         CDS       T05247                                 

Gene name
GCK
Definition
(RefSeq) glucokinase isoform X1
  KO
K12407  glucokinase [EC:2.7.1.2]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00010  Glycolysis / Gluconeogenesis
oor00052  Galactose metabolism
oor00500  Starch and sucrose metabolism
oor00520  Amino sugar and nucleotide sugar metabolism
oor00524  Neomycin, kanamycin and gentamicin biosynthesis
oor01100  Metabolic pathways
oor01200  Carbon metabolism
oor04910  Insulin signaling pathway
oor04911  Insulin secretion
oor04917  Prolactin signaling pathway
oor04922  Glucagon signaling pathway
oor04930  Type II diabetes mellitus
oor04950  Maturity onset diabetes of the young
oor05230  Central carbon metabolism in cancer
Module
oor_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
oor_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101286839 (GCK)
   00052 Galactose metabolism
    101286839 (GCK)
   00500 Starch and sucrose metabolism
    101286839 (GCK)
   00520 Amino sugar and nucleotide sugar metabolism
    101286839 (GCK)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101286839 (GCK)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101286839 (GCK)
   04910 Insulin signaling pathway
    101286839 (GCK)
   04922 Glucagon signaling pathway
    101286839 (GCK)
   04917 Prolactin signaling pathway
    101286839 (GCK)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    101286839 (GCK)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101286839 (GCK)
   04950 Maturity onset diabetes of the young
    101286839 (GCK)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     101286839 (GCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 101286839
NCBI-ProteinID: XP_004283013
LinkDB All DBs
Position
Unknown
AA seq 465 aa AA seqDB search
MLDDRARMEIAKKEKVEQILAEFQLQDEDLKKVMRRMQKEMDRGLRLETHKEASVKMLPT
YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAE
MLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNN
IVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRRCEVGMIVGTGCNACYMEEMQN
VELVEGDEGRMCVNTEWGAFGDSGELDEFLLEYDRVVDENSLNPGQQLYEKLIGGKYMGE
LVRLVLLKLVDENLLFHGEASEKLRTRSAFETRFVSQVESDSGDRKQIYNILSTLGLRPS
ATDCDIVRRACESVSTRAARMCAAGLAGVINRMRESRSEDVMRITVGVDGSVYKLHPSFK
ERFHAGVRRLTPSCEITFIESEEGSGRGAALISAVACKKACMLGQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgacagagccaggatggagatcgccaagaaggaaaaggtggaacagatcctg
gcggagttccagctgcaggacgaggacttgaagaaggtgatgaggcggatgcagaaggag
atggaccgaggcctgaggctggagacacacaaggaggccagtgtgaagatgctgcccacc
tacgtgcgctctaccccggaaggctcagaagtcggggatttcctctccctggacctgggc
ggcaccaacttcagggtgatgcttgtgaaggtgggggaaggggaggagggacagtggagt
gtgaaaaccaagcaccagatgtactccatccccgaggacgccatgacgggcactgctgag
atgctctttgactacatctctgagtgcatctccgacttcctggacaagcatcagatgaag
cacaagaagctacccttgggcttcaccttctcctttcctgtgaggcacgaagacatcgac
aagggcatccttctcaactggaccaagggcttcaaggcctcaggagcagaagggaacaac
atcgtggggctcctgcgagatgccatcaaacggagaggggactttgagatggacgtggtg
gcgatggtgaacgacactgtggccacgatgatctcctgctactatgaagaccgccggtgt
gaggttggcatgattgtgggcacgggctgcaacgcctgctacatggaggagatgcagaac
gtggagctggtggaaggggacgagggccgcatgtgtgtcaacaccgagtggggtgccttc
ggggactcgggcgagctggacgagttcctgctggagtacgaccgtgtggtggacgagaac
tccctgaaccccggccagcagctgtacgagaagctcatcggcggcaagtacatgggcgag
ctggtgcggctcgtgctgctgaagcttgtggacgagaacctgctcttccatggggaggcc
tcggagaagctgcgcacgcgcagcgccttcgagacacgcttcgtgtcgcaggtggagagt
gactcgggcgaccgcaagcagatctacaacatcctgagcacgctggggctgaggccgtcg
gccaccgactgcgacatcgtgcgccgtgcctgcgagagcgtgtccacccgcgccgcgcgc
atgtgcgccgcggggctggcgggcgtcatcaaccgcatgcgcgagagccgcagcgaggac
gtgatgcgcatcaccgtgggcgtggacggctcagtatacaagctgcaccccagcttcaag
gagcggttccacgccggcgtgcgcaggctgacgcccagctgtgaaatcaccttcatcgag
tcggaggagggcagcggccggggtgcggccttgatctccgcggtggcctgtaagaaggcc
tgcatgctgggccagtga

DBGET integrated database retrieval system