KEGG   Orcinus orca (killer whale): 101287264
Entry
101287264         CDS       T05247                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01522  Endocrine resistance
oor04012  ErbB signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04110  Cell cycle
oor04151  PI3K-Akt signaling pathway
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor04934  Cushing syndrome
oor05162  Measles
oor05165  Human papillomavirus infection
oor05169  Epstein-Barr virus infection
oor05200  Pathways in cancer
oor05202  Transcriptional misregulation in cancer
oor05203  Viral carcinogenesis
oor05206  MicroRNAs in cancer
oor05215  Prostate cancer
oor05220  Chronic myeloid leukemia
oor05222  Small cell lung cancer
oor05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101287264 (CDKN1B)
   04066 HIF-1 signaling pathway
    101287264 (CDKN1B)
   04068 FoxO signaling pathway
    101287264 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    101287264 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101287264 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101287264 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    101287264 (CDKN1B)
   05206 MicroRNAs in cancer
    101287264 (CDKN1B)
   05203 Viral carcinogenesis
    101287264 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    101287264 (CDKN1B)
   05220 Chronic myeloid leukemia
    101287264 (CDKN1B)
   05215 Prostate cancer
    101287264 (CDKN1B)
   05222 Small cell lung cancer
    101287264 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101287264 (CDKN1B)
   04934 Cushing syndrome
    101287264 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    101287264 (CDKN1B)
   05169 Epstein-Barr virus infection
    101287264 (CDKN1B)
   05165 Human papillomavirus infection
    101287264 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101287264 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101287264
NCBI-ProteinID: XP_004281183
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGNLPEFYYRPPRPPKGACKVPAQEGQDVSGTRQAVPLIG
SQANSEDTHLVDQKTDAPDSQTGLAEQCTGIRKRPATDDSSSQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcttggagcggatggacgccagacag
gcggagtaccccaagccctcggcctgcagaaacctcttcggcccggtcaatcacgaagag
ttaacccgggacttggagaagcactgtagagacatggaagaggccagccagcgcaagtgg
aattttgattttcagaatcacaagcccttggagggcaaatacgagtggcaagaggtggaa
aagggcaacttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagggccaggatgtcagcgggacccgccaggcggtgcctttaattggg
tctcaggcaaactcagaggacacgcatttggtagaccagaagactgatgcaccggacagc
cagacggggttagcggagcagtgcactgggataaggaagcgacctgccacagacgattcc
tcttctcaaaacaaaagagcaaacagaacagaagaaaatgtttcagacggttccccgaac
gcgggatcagtggagcagacgcccaagaagccgggcctcagaaggcgtcaaacgtaa

DBGET integrated database retrieval system