KEGG   Orcinus orca (killer whale): 101287634
Entry
101287634         CDS       T05247                                 

Gene name
CACNA1E
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04010  MAPK signaling pathway
oor04020  Calcium signaling pathway
oor04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101287634 (CACNA1E)
   04020 Calcium signaling pathway
    101287634 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101287634 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oor04040]
    101287634 (CACNA1E)
Ion channels [BR:oor04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101287634 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 101287634
NCBI-ProteinID: XP_004269874
LinkDB
Position
Unknown
AA seq 2314 aa
MARFGEAVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECRDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTSVLYSTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRRHMQMPSQEALNKEEAPPMNPLNPLNPLSSLHPLNAHPSLYRRPRPIEGPALGL
GLEKCEEERVSRGGSLQGDGGDLSSALDNQRSPVSLGKREPPWLARPCHGNCDPTQQEAG
GGETVVAFEDRARHRQSQRRSRHRRVRTEGKESSSASRSRSASQERSLDEAVPSEGERDL
EPRDSHGGKEPTIQEEERSQDLRRTNSLMVHRRSGLAGALDEANTPLALPQPELQAEKDA
ALTEQEPEGSSEQALLGDVQLDMGRVISQSEPDLSCTTANTDRAAPESTSVTVAIPDVDP
LVDSTVVHISSKTDGEASPLKEAEIKEDEEEVEKKQQKKEKRETGKAMVPHSSMFIFSTT
NPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTF
EMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGSNKGRDIKTIKSLRV
LRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCT
DSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQ
HSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSL
EKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKY
YSAPCTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIIL
TDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFF
IYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCE
PDTTAPSGQSESERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPH
HLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAE
DMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPK
ASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALP
YLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQPS
NHGIYLPSDTQEHAGSGRASSMPRLTVDPQVVTDPSSIRRSFSTIREKRSNSSWLEEFSM
ERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSR
CNSEERGTQADWESPERHQSRSPSECRSQTSNRPGTGSLSESSIPSVSDTSTPRRSRRQL
PPVPPKPRPLLSYSSLIRHTGSISPPADGSEGGSPLTSQALEGNDASLPEPCNPRYVQQG
HPSSPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMP
NGHYRRRRHGGPGPGMMCGAVSDLLSDTEEDDKC
NT seq 6945 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcggcaggccggggtcgggagatggagattcggac
cagagcaggaaccggcaaggaacccccgtgccggcctccgggccggcggccgcctacaag
cagtcgaaagcgcagagggcgcggactatggctttgtacaaccccattcccgtccggcag
aactgtttcaccgtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tacgccaagaagctcatcgattggccgccgtttgagtacatgatcttggccaccatcatt
gccaactgcatcgtcttggccctggagcaacatcttcctgaggatgacaagaccccaatg
tcccgcagactggagaagacagaaccgtatttcatcgggatcttttgctttgaagctggg
atcaaaatcgtagccctggggttcatcttccataagggctcgtacctccgcaatggctgg
aatgtcatggacttcatcgtggtcctcagtggcatcctggccactgcgggaacccacttc
aacacacatgtggacctgaggacgctccgggctgtgcgtgtcctaaggcccctgaagctc
gtgtcggggatacctagcctgcagattgtgttgaagtccatcatgaaggccatggtgcct
ctgctgcagattggccttctgctcttcttcgccatcctgatgtttgcgatcatcggcttg
gagttctacagtgggaagctgcaccgagcttgcttcatgaacaattcaggtattctagaa
ggatttgacccccctcacccatgtggtgtgcagggctgcccagctggttatgaatgccgg
gactggatcggccccaatgacgggatcacccagtttgataacatcctttttgctgtgctg
actgtcttccagtgcatcaccatggaagggtggaccagtgtgttatatagtaccaatgat
gccttaggagccacctggaattggctgtacttcatcccactgatcatcattggatccttc
tttgttctcaacctcgtcctgggagtgctttctggggaatttgccaaagagagagagaga
gtggagaaccggagagctttcatgaaactgcggcgccagcagcagatcgagcgtgaactg
aatgggtaccgcgcgtggatagacaaagcagaggaagtcatgctcgctgaagaaaataaa
aatgctggaacgtcagccttagaagtgctccgaagggcaaccatcaaaaggagccggacg
gaggccatgacgcgggactccagcgacgagcactgtgtcgacatctcctctgtgggcaca
cccctcgcccgagccagcatcaagagtacaaaggtggacggggcctcctacttccggcac
aaggagcggcttctgcgtatctctatccgccacatggttaaatcccaggtgttttattgg
attgtgctgagccttgtggctctcaacaccgcctgtgtggccatcgtccatcacaaccag
ccccagtggctcacccacctcctctactatgcagaatttttgtttctgggactcttcctc
ctggagatgtccctgaagatgtacggcatggggcctcgcctttattttcactcttcgttc
aactgctttgattttggggtcacagtgggcagcatctttgaagtggtctgggcgatcttc
agacctggtacatcttttggaatcagtgtcttgcgagctctccggcttctaagaatattt
aaaataaccaagtattgggcatccctccggaatttggtggtctccttgatgagttccatg
aagtcaatcatcagtttgctcttccttctcttcctcttcatcgttgtctttgctctccta
ggaatgcagctgtttggaggcaggttcaactttaatgatgggactccttcagcaaacttt
gacaccttccctgcagccatcatgactgtattccagatcctgacgggtgaggactggaat
gaggtgatgtacaatgggatccgctcccagggtggggtcagctcaggcatgtggtcagct
atctatttcattgtgctcaccttgtttggaaactacacactgctgaatgtgttcttggcc
atcgctgtggacaatctggccaatgcccaggagctgaccaaggatgaacaggaagaagag
gaggccttcaaccagaaacacgcgctgcagaaggccaaggaggtcagcccgatgtctgca
cccaacatgccttccatcgaaagagacagaaggagaagacaccacatgtcgatgtgggag
ccacgcagcagccacctgagggagcgaaggcgccgacaccacatgtcggtgtgggagcag
cgcaccagccagctgagaaggcacatgcagatgcccagccaggaggccctcaacaaggag
gaggccccacccatgaaccccctcaaccccctcaaccccctgagctccctccacccactc
aatgcccaccccagcctctaccggagacccaggcccatcgaggggccggccctgggcctg
ggtctggagaagtgtgaggaggagcgcgtcagccgcggggggtccctccagggggacgga
ggggacctgtcgagtgccctggacaaccagaggagccccgtgtccctgggcaaacgggag
ccgccctggctggccaggccctgtcatgggaactgtgacccgacccagcaggaggccggg
ggcggggagaccgtggtggccttcgaggaccgggccaggcacaggcagagccagcggcgc
agccggcaccgccgcgtcaggacggagggcaaggagtcctcctccgcttccaggagcagg
tctgccagccaggagcggagtctggatgaagctgtgcccagtgagggggagagggacctc
gagcccagggacagccatgggggcaaggagcccacaatccaggaggaagagcgatcccag
gacttaaggaggaccaatagtctgatggtgcacagacgctccgggctggcaggagccctc
gacgaggccaacacacccctcgccctgccccaaccagagctgcaagcggagaaggatgca
gcgctgacggaacaggagccggagggcagcagtgagcaagccctgctgggggacgtgcag
ctggacatgggccgggtcatcagccagagtgagcccgacctctcctgcaccacggccaac
acggacagggctgcccccgagagcaccagcgtcaccgtcgccatccctgacgtggacccc
ttggtggactcgaccgtggtgcacatcagcagcaagactgatggagaagccagtcccttg
aaagaggcagagatcaaagaggatgaggaggaagtggagaagaagcagcagaagaaggag
aagcgtgagacgggcaaagccatggtgcctcacagctcaatgttcatcttcagcaccacc
aacccgatccgcagggcctgccactacatcgtgaacctgcgctactttgagatgtgcatc
ctcctggtgatcgcagccagcagcattgccctggcggccgaggaccccgtcctgaccaac
tcggagcgcaacaaagtgctgaggtattttgactatgttttcactggcgtcttcaccttt
gagatggttataaagatgatagaccagggcttgatcctgcaggatgggtcctacttccga
gacctgtggaacatcctcgactttgtggtagtggttggtgcattggtggcctttgctctg
gcgaatgccttgggaagcaacaagggccgggacatcaagaccatcaagtccctgcgggtg
ctgcgtgtgctgagaccgctcaagaccatcaagcgcctgcccaagctcaaggctgtcttc
gactgtgtggtcacctccttgaaaaatgtcttcaacatactaattgtctataagctcttc
atgttcatctttgctgtcatcgcagttcaacttttcaagggcaagttcttctattgcaca
gacagttccaaggacacagagaaggagtgcataggaaactatgtagatcacgagaaaaac
aagatggaggtgaaaggccgagaatggaagcgccatgaattccactatgacaacatcatc
tgggccctgctgaccctcttcaccgtctccacaggggaaggatggcctcaagttttgcag
cattctgtcgatgtgacagaggaagaccgaggcccgagccgcagcaaccgcatggagatg
tccatcttttacgtggtctactttgtggtctttcctttcttcttcgtcaacatctttgtg
gctctcatcatcatcaccttccaggagcaaggggacaagatgatggaggagtgcagcctg
gagaagaacgagagggcgtgcatcgacttcgccatcagtgccaaaccactcacccgctac
atgccccagaacaggcacaccttccagtaccgcgtctggcactttgtggtgtctccatcc
tttgagtacaccatcatggccatgatcgccctgaacactgtcgtgctgatgatgaagtac
tactctgctccgtgtacctatgaactggccctgaagtacctgaatatcgccttcaccatg
gtgttctccctggaatgtgtcctaaagatcattgcgtttggcttcttgaactatttccga
gacacctggaacatctttgacttcatcacggtgattggcagtatcacagaaattattctg
acagacagcaagctggtgaacaccagtggcttcaatatgagctttctgaagctcttccga
gccgcccgcctcatcaagcttctgcgtcaaggctacaccatccgtattttactttggacc
ttcgtgcagtcctttaaggccctcccctacgtctgccttctgattgccatgcttttcttc
atctatgccatcattgggatgcaggtctttggaaacataaaattagatgaggagagtcac
atcaaccggcacaacaacttccggagtttctttgggtccctcatgctactcttcaggagt
gccacgggtgaggcctggcaggagataatgctgtcgtgcctcggggagaagggctgtgag
cctgacaccaccgcaccctcagggcagagcgagagcgagcgctgtggcaccgacctggcc
tacgtgtacttcgtctctttcatcttcttctgttccttcttgatgctcaacctgttcgtg
gccgtcatcatggacaactttgagtacctgactcgggattcatccatcctggggcctcac
cacctggacgagtttgtccgtgtctgggcagagtatgacagagcggcatgtggccgcatc
cattacactgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctcggcaag
agatgtccctccaaggtggcatataagaggttagtcctgatgaatatgccggtggctgag
gacatgactgtccacttcacttccacgcttatggctctgatccggacagctctggacatt
aaaatcgccaaaggtggtgcggacaggcagcagctagactcagagctacagaaggagacc
ctggccatctggcctcacctgtcccagaagatgttagatctgcttgtgcccatgcccaaa
gcctctgacctgactgtgggcaaaatctatgcagcaatgatgatcatggactactataaa
cagagcaaggtgaagaagcagaggcagcagctggaggaacagaaaaacgcacccatgttc
cagcggatggagccgtcatctctgcctcaggagatcattgctaatgccaaagccctgcct
tatctccagcaggaccccgtttcaggcctgagtggccggagtggatacccttcgatgagt
ccactctctccgcaggaaatattccagttggcctgtatggacccagctgacgatggacaa
ttccaggaacagcaatctctggagccagaggttagtgaattaaaaagcgtgcagccctct
aaccatggcatctaccttccttcggacacccaggagcatgcgggatctgggagggcatcc
tctatgccacgcctgactgtggatccccaggtggtgacagaccctagctccataagacgt
tcattttccactattcgggaaaagcgttcaaattcctcttggctggaggaattctccatg
gagcgaagcagcgaaaacacctacaagtcgcgtcgccggagttaccactcctccctgagg
ctgtcagcccaccgcctgaactctgactcaggccacaagtccgacacccaccgctcaggg
ggcagagagcggggacgatcgaaagagcgaaagcatcttctctctcccgacgtctcccgc
tgcaactccgaggagcgagggacccaggccgactgggagtccccagaacgtcatcagtcc
cggtctcccagcgagtgcaggtcgcagacctccaacagaccgggcacagggtccctcagt
gaaagctccattccctccgtctccgacaccagcaccccaagacgaagtcgtcggcagctc
ccacctgtccctccgaagcctcggcccctcctttcctacagctccctgataagacacact
gggagcatctccccacctgctgatgggagcgagggtggctccccactgacctcccaagct
ctggagggcaatgacgccagcctgcccgagccttgcaacccccggtacgtacagcagggc
cacccctcctccccacagcgctacatctctgagccctacctggccctgcacgaagactcc
cacgcctcggactgtggcgaggaggagacgctcacctttgaagcagctgtggcgaccagc
ctcggccggtccaacaccatcggctcagccccgcccctgcggcacagctggcagatgccc
aatgggcactatcggcggcggaggcacggggggcctggaccaggcatgatgtgtggagcc
gtcagcgaccttctgagcgatacggaagaagacgacaaatgctag

DBGET integrated database retrieval system