KEGG   Orcinus orca (killer whale): 101288384
Entry
101288384         CDS       T05247                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01522  Endocrine resistance
oor01524  Platinum drug resistance
oor04012  ErbB signaling pathway
oor04066  HIF-1 signaling pathway
oor04068  FoxO signaling pathway
oor04110  Cell cycle
oor04115  p53 signaling pathway
oor04151  PI3K-Akt signaling pathway
oor04218  Cellular senescence
oor04630  JAK-STAT signaling pathway
oor04921  Oxytocin signaling pathway
oor04928  Parathyroid hormone synthesis, secretion and action
oor04934  Cushing syndrome
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05163  Human cytomegalovirus infection
oor05165  Human papillomavirus infection
oor05166  Human T-cell leukemia virus 1 infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05169  Epstein-Barr virus infection
oor05200  Pathways in cancer
oor05202  Transcriptional misregulation in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05211  Renal cell carcinoma
oor05212  Pancreatic cancer
oor05213  Endometrial cancer
oor05214  Glioma
oor05215  Prostate cancer
oor05216  Thyroid cancer
oor05217  Basal cell carcinoma
oor05218  Melanoma
oor05219  Bladder cancer
oor05220  Chronic myeloid leukemia
oor05222  Small cell lung cancer
oor05223  Non-small cell lung cancer
oor05224  Breast cancer
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101288384 (CDKN1A)
   04630 JAK-STAT signaling pathway
    101288384 (CDKN1A)
   04066 HIF-1 signaling pathway
    101288384 (CDKN1A)
   04068 FoxO signaling pathway
    101288384 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    101288384 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101288384 (CDKN1A)
   04115 p53 signaling pathway
    101288384 (CDKN1A)
   04218 Cellular senescence
    101288384 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101288384 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    101288384 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101288384 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    101288384 (CDKN1A)
   05206 MicroRNAs in cancer
    101288384 (CDKN1A)
   05205 Proteoglycans in cancer
    101288384 (CDKN1A)
   05203 Viral carcinogenesis
    101288384 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101288384 (CDKN1A)
   05212 Pancreatic cancer
    101288384 (CDKN1A)
   05225 Hepatocellular carcinoma
    101288384 (CDKN1A)
   05226 Gastric cancer
    101288384 (CDKN1A)
   05214 Glioma
    101288384 (CDKN1A)
   05216 Thyroid cancer
    101288384 (CDKN1A)
   05220 Chronic myeloid leukemia
    101288384 (CDKN1A)
   05217 Basal cell carcinoma
    101288384 (CDKN1A)
   05218 Melanoma
    101288384 (CDKN1A)
   05211 Renal cell carcinoma
    101288384 (CDKN1A)
   05219 Bladder cancer
    101288384 (CDKN1A)
   05215 Prostate cancer
    101288384 (CDKN1A)
   05213 Endometrial cancer
    101288384 (CDKN1A)
   05224 Breast cancer
    101288384 (CDKN1A)
   05222 Small cell lung cancer
    101288384 (CDKN1A)
   05223 Non-small cell lung cancer
    101288384 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101288384 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101288384 (CDKN1A)
   05161 Hepatitis B
    101288384 (CDKN1A)
   05160 Hepatitis C
    101288384 (CDKN1A)
   05163 Human cytomegalovirus infection
    101288384 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101288384 (CDKN1A)
   05169 Epstein-Barr virus infection
    101288384 (CDKN1A)
   05165 Human papillomavirus infection
    101288384 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101288384 (CDKN1A)
   01522 Endocrine resistance
    101288384 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101288384
NCBI-ProteinID: XP_012387700
LinkDB
Position
Unknown
AA seq 164 aa
MSEPSRDAHQIPRGSKACRRLFGPVDSEQLRRDCDALMASCVQEARDRWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPAGPRGTRDDLGGGKWPSTSSALLQGTSQEDHVDLSLSCTLV
PRSPERPEGSPGGPGTSQGRKRRQTSMTDFYHSKRRLISSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcagagccatccagggatgcccatcagatcccacgcggcagcaaggcgtgccgccgc
ctctttggcccggtggacagtgagcagctgcgccgggactgcgacgccctgatggccagc
tgcgtgcaggaggcccgagatcgatggaacttcgactttgtcaccgagacccctctggag
ggtgacttcgcctgggagcgcgtgaggggccttggcctgcccaagctttacctgcctgca
gggccccgggggacccgggacgacctgggagggggcaagtggccgagcacctcatctgcc
ctgctgcaggggacatctcaggaggaccacgtggacctgtcactgtcctgtaccctcgtg
cctcgctccccagagcggcctgaggggtccccgggagggccgggcacctcccagggacga
aaacggcgacagaccagcatgacagatttctatcactctaaacgccggctgatcagctcc
aagaggaagccctaa

DBGET integrated database retrieval system