KEGG   Orcinus orca (killer whale): 101288403Help
Entry
101288403         CDS       T05247                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal isoform X1
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00052  Galactose metabolism
oor00500  Starch and sucrose metabolism
oor01100  Metabolic pathways
oor04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101288403
   00500 Starch and sucrose metabolism
    101288403
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101288403
Enzymes [BR:oor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101288403
    3.2.1.20  alpha-glucosidase
     101288403
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 Abhydro_lipase
Motif
Other DBs
NCBI-GeneID: 101288403
NCBI-ProteinID: XP_012389365
LinkDB All DBs
Position
Unknown
AA seq 1820 aa AA seqDB search
MARKKLKKFTTLELMLSVLLLVVFIITVPLFVLSARDSLESEDPGKSTTPGPAECPVVNE
LERINCIPDQSPTKAMCDQRGCCWKPQGPISVPWCYYSKSHGYQVEGNLVNTNAGFTAQL
KRLPSPSLFGNDVNNVLLTAEYQTSNRFHFKLTDQNQDRYEVPHEHVQPFKGNAASSLAY
EVEVSEQPFSIKVIRTSNNHVLFDSSIGPLLFADQFLQLSIRLPSANVYGLGEHVHQQYR
HDMNWKTWPIFARDTIPKGDGTNLYSAQTFFLCLEDASGLSFGVFLMNSNAMEVSLQPTP
AVTYRTTGGILDFYVFLGNTPEQVVQEYQELIGRPALPSYWALGFHLSRYDYGTLGNMKE
VMERNRAAQLPYDVQHADIDYMHERKDFTYDPVNFKGFPEFVKELHNNGQKLVIIVDPAI
SNNSSPSNPYGPYDRGSDMKIWVNASDGVTPLIGEVWPGKTVFPDYTNPKCTAWWANECE
LFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNYPPFTPRILDGYLFCKSLCMDAVQH
WGKQYDVHNLYGYSMAIATAEAVKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNAATWND
LRWSIPGMLEFSLFGIPMVGSDICGFTLDAPEELCRRWMQLGAFYPFSRNHNGQGYKAQD
PASFGADSLLLNSSRHYLTIRYALLPYLYTLFYRAHSQGDTVARPLLHEFYEDSNTWDVQ
EQFLWGPGLLITPVLAEGAEKVTAYVPDAVWYDYETGGRVKWRKQKVEMELPGDKIGLHL
RGGYIFPTQQPATTTVASRRNPLGLIIALDDNKEAKGELFWDDGETKDTMANKVCLFCEF
SVTQNRLDVKILQSTYTDPNNLAFKEIKILGTQEPTNVTVKHNGVKIQVSPNVTYDSNLQ
VALITEIDLVLGEIYTVEWDVKIRDAEKIDCYPDENGASAENCTARGCVWEVSGSPGVPF
CYFVNDLYSVSDVQYDLHGATAVLSLKSSYASSLPSVPVNSLRLNVTYHKDNMLQFKIYD
PNNNRYEVPVPLNIPRVPSSTSESRLYDVLIKKNPFGIEIRRKSTGTVIWDSQLLGFTFN
DMFIRISTRLPSQYLYGFGETEHTAFRRDLNWNTWGMFSRDQPPGYKKNSYGVHPYYMAL
EEDGNAHGALLLNSNAMDVTFQPLPAVTYRTTGGILDFCVFLGPTPELVTQQYTELIGRP
VMVPYWSLGFQLCRYGYKNDAEIGSLYDEMVAAQIPYDVQYADIDYMERQLDFTLSPEFE
GLPALITRMKANGMRVILILDPAISGNETKPYPPFTRGVEDDVFIKDPNDGSIVWGKVWP
DFPDMVINSSLDWESQVEQYRAYVAFPDFFRNSTITWWKRELREMYTNPRDPEKSLKFDG
IWIDMNEPANFVSGAVPPGCKDACLNHPPYMPYLESRDRGLSSKTLCMESQQLLPDGSPV
RHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGHWGGHWLGDNTAAWDQLRK
SIIGMMEFSLFGISFTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNSIGARRQDPVS
WDSTFVTISRSVLQTRYTLLPYLYTLMHRANTEGSTVVRPLLHEFVSDQVTWDVDSQFLL
GPAFLVSPVLEPNARNVTAYFPRARWYDYYTGVDIQARGEWKTLPAPLDHINLHVRGGYI
LPWQEPAQNTHLSRQKFTGFKVALDDEGTAEGWLFWDDGQSIDTYGKGLYYLARFSVSQN
TMHSHVIFNKYISDTNPLKLGYIEIWGVGSVSVSGVSISVSSMVITPTFSYNSTTQVLNI
DVTSRNLSLHNFTSLTWRAL
NT seq 5463 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagttgaaaaagttcactactttggagcttatgctcagtgttcttctg
cttgtggtgtttatcatcactgttcctctctttgtgctttcagccagagattctttggaa
tcagaagatcctgggaaaagtaccactcctggtcctgccgagtgcccagtggtaaatgaa
ttggaacggataaactgcatccctgaccagtcaccaacaaaggccatgtgtgaccagcgt
gggtgctgctggaaacctcagggacccataagtgtgccctggtgctactattctaagagt
catggctatcaagtggagggcaaccttgtgaacacaaatgcaggattcacagcccagttg
aaaaggttgccttctccatctctttttggaaatgatgtcaacaacgtccttctcacagcg
gaataccagacgtctaaccgtttccactttaagttaactgaccaaaaccaggacagatac
gaagtgccccatgaacatgtgcaacccttcaaaggaaatgctgcttcttccttggcctat
gaagttgaggtctccgaacagccatttagcatcaaagtgatcagaacgagcaacaatcac
gttctgtttgactccagcatcgggcccctgctgtttgctgatcagttcctgcagctctcc
atccgactgcctagtgctaacgtgtatggtctgggagaacacgtgcaccagcagtaccgg
cacgatatgaattggaagacctggcccatatttgccagggacacaatccccaaaggggac
ggaactaacttgtatagtgcacagacattcttcctatgccttgaagatgctagtggattg
tcctttggagtgtttctgatgaacagcaatgccatggaggtttccctccagcccacccca
gctgtcacttaccgtaccactgggggcattctcgacttctacgtgttcttgggaaacact
ccagagcaagtggttcaagagtatcaagagctcattggacggccagccctaccctcatac
tgggcacttgggtttcatctcagtcgttatgactatggaaccctgggtaacatgaaagaa
gtcatggagagaaaccgtgccgcacagctgccttacgacgttcagcatgctgatattgat
tatatgcatgagaggaaggacttcacttatgatccagtaaattttaagggcttccctgag
tttgttaaagagttacacaataacggacaaaaattggtcatcattgtggatccagccatc
tccaacaactcttccccaagtaatccctatggcccatatgacaggggttcagatatgaag
atatgggtgaatgcttcagatggagtgactccactcattggggaggtctggcctggaaaa
actgtgtttcctgattacaccaaccccaagtgtactgcttggtgggcaaatgaatgtgag
cttttccacaatcaagtagaatttgatggaatctggattgatatgaatgaagtctccaac
ttcgtggatggttcagtttcaggatgttccacaaacaatctaaattatcccccattcact
cccagaatcctggatgggtacctgttctgcaagagtctctgcatggatgcagtacagcac
tggggcaagcaatacgatgtccacaatctgtatggctactccatggcaattgccacagca
gaagctgtcaagactgtgttccctaacaagagaagcttcattttaacccgttctaccttt
gcggggtctggcaagtttgcagcccactggttaggagacaacgcagccacctggaatgac
cttcgatggtccatccctggcatgctcgagttcagcctttttggtatcccaatggtgggt
tctgacatatgtggctttacattggatgctcccgaagagctctgcaggaggtggatgcag
ctgggagcattctatccattttccaggaatcacaatggccaaggctacaaggcccaggat
cctgcctcctttggagctgactctctgctgttgaattcctccaggcactaccttaccatc
cgctatgctctattgccctatctctacaccctcttctaccgtgctcacagccagggggac
acggtggccaggccccttctgcatgagttctacgaggacagcaacacttgggatgtgcag
gagcagtttttatgggggcccggcctcctcatcactccggttctggccgagggtgcagag
aaagtgacagcatatgtgcctgatgccgtctggtatgactatgagactgggggccgagtg
aaatggaggaagcaaaaagtggagatggaacttcctggagacaaaattggacttcacctt
cgaggaggctacatcttccccacacagcagccagccacaaccactgtggccagtcgaagg
aaccctcttggtcttatcattgccctggatgacaacaaagaagcaaaaggcgaacttttc
tgggatgatggggaaacgaaagatactatggccaataaagtttgcctcttctgtgagttc
tccgtcacccaaaaccgcttggatgtgaagattttgcaatcaacctacacagaccccaat
aatttagcatttaaagagattaaaatccttgggacccaggaacctaccaatgttacagtg
aaacacaatggtgtcaaaattcaagtttctcctaatgtcacttatgattctaacctccag
gtggcccttatcacagaaattgatcttgtcctgggagaaatatacacggtggagtgggat
gtgaagataagggatgcagaaaaaatagactgttatcctgatgagaatggtgcttctgca
gaaaactgtactgcccgcggctgtgtctgggaggtatccggttctcctggagtccctttt
tgctattttgtcaatgatctatactctgtcagtgatgttcagtatgacttacatggggcc
acagctgtcctctccttaaagtcttcgtatgcctcctctttgccctccgtacccgtgaac
tccctccgtctgaatgtgacctaccataaggataacatgctgcagtttaagatttatgat
cccaacaacaaccggtatgaagttccagtccctctcaacatacccagggttccatccagc
acctctgagagtcgactctatgatgtcctcattaagaagaatccttttgggattgaaatt
cgccggaagagtacaggcactgtaatttgggactctcagctccttggcttcaccttcaac
gacatgttcatccgcatctccacgcgcctcccctcccagtacctctatggctttggggaa
actgagcacacagcctttcgaagagacttgaactggaacacgtggggaatgttttcccga
gaccagcccccggggtacaagaagaattcctatggtgtccacccctactacatggcactg
gaggaggatggcaatgcccacggggccctgctgctgaacagcaacgccatggatgtgaca
ttccagcccttgcctgccgtgacataccgcaccacaggaggaattctggacttctgtgtc
ttcttggggccaacgccagagcttgtcactcagcagtatactgagttgattggtcggcca
gtgatggttccttattggtccttggggtttcagctgtgtcgctatggatacaagaacgac
gctgagattggtagcttgtatgatgagatggtggctgcccagatcccctatgacgtgcag
tacgcggacatcgactacatggagcggcagctggacttcaccctcagccccgagtttgag
gggcttccagctctgattactcgaatgaaggccaatgggatgcgggtcatcctcattctg
gacccagccatttctggcaacgagacaaagccctatccccctttcacgcggggtgtggag
gacgatgtcttcatcaaagatccgaatgatggaagcattgtttggggaaaggtctggcct
gattttcctgatatggttatcaacagttctctagactgggaaagtcaagtggagcaatac
cgagcttatgtggccttcccagactttttccgtaattcaaccatcacatggtggaaaagg
gagttgagagaaatgtacaccaatccacgggatccagagaagagcttgaagtttgatggc
atatggattgatatgaatgaaccggcaaacttcgtgagtggggcagtccctccaggctgc
aaggatgcctgtctgaaccaccctccctacatgccatatttggagtccagggacaggggc
ctgagcagcaagaccctgtgcatggagagccagcagctcctgcctgacggctccccggtg
cggcactacgacgtgcacagcctgtacgggtgggcccagaccagacccacgtacgaagct
gtgcaggaggtgacgggacagcgagggatcgtcatcactcgctccacttttccttcttct
ggccactggggaggacactggctgggtgacaacacggccgcgtgggaccagctgaggaaa
tctatcattggcatgatggagtttagcctctttggcatatcctttacaggagcagatatt
tgtggattctttcaagatgctgaatatgaaatgtgtgttcgctggatgcagctgggggcc
ttttaccccttctcaaggaaccacaacagcattggggccaggaggcaagaccctgtgtcc
tgggattctacctttgtgactatctccagaagtgtcctgcagaccagatacaccctgttg
ccatatctgtacaccctgatgcacagggccaacacggagggcagcactgtcgtgcggcct
cttctccatgagtttgtgtcagaccaggtgacctgggatgtagacagtcagttccttctg
ggcccagccttcctggtcagccctgtcctggagcctaacgccagaaatgtcactgcatat
ttccctagagcccgctggtatgattactacacgggtgtggacattcaagcccggggagag
tggaagaccttgccagcgcctcttgaccacattaatctccatgtccgtgggggctacatc
ctgccctggcaagagcctgcacagaacacccacttaagccgtcagaaattcacaggcttc
aaggttgccttggatgatgaggggactgctgaaggttggctcttctgggatgatgggcaa
agcattgatacctatgggaaaggactctactacctggcccgcttttctgtcagccagaat
acaatgcacagtcatgtaattttcaacaaatacatcagcgatacaaaccctttgaaactg
ggctacattgagatctggggagtgggcagtgtctccgtttccggtgtcagcatctctgtg
agcagcatggttataacacccaccttctcctacaactctacaacacaggtgttaaacatt
gatgtgaccagcagaaacctcagcttacacaatttcacttcattgacatggagagcactc
tga

DBGET integrated database retrieval system