KEGG   Orcinus orca (killer whale): 101288524Help
Entry
101288524         CDS       T05247                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00500  Starch and sucrose metabolism
oor01100  Metabolic pathways
oor04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101288524
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101288524
Enzymes [BR:oor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     101288524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 101288524
NCBI-ProteinID: XP_004263147
LinkDB All DBs
Position
Unknown
AA seq 511 aa AA seqDB search
MKLFLLLSAIGFCWAQYAPNTESGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSSP
NENAVINNPSRPWWERYQPVSYKLCTRSGNENEFKDMVTRCNNVGVRIYVDAVINHMCGN
GVAAGTSSTCGSYFNPGTEDFPAVPYSGWDFNDGKCKTRSGEIESYNDASQVRDCRLVGL
LDLALEKDYVRSTIAEYLNRLIDIGVAGFRIDAAKHMWPGDMKAILDKLHNLNKRWFPAG
SKPFIYQEVIDLGGEPIKSSEYFGNGHVTEFKYGAKLGTVLRKWNGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNQRGSGAGGASILTFWDPRLYKMGVGFMLAHPYGFTRVMSSYRWP
RHFENGKDVNNWIGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVVFRNVVDGQP
FTNWWDNGSNQVAFGRGNRGFIVFNNDDWALSSTLQTGLPAGTYCDVISGDKIGNYCTGI
KIYVSGDGNANFSISNSAEDPFIAIHAESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctttctattgctttcagccattggattctgctgggctcagtatgccccaaat
accgaatctggacggacatctattgtccatctgtttgagtggcgctgggttgatattgct
cttgaatgtgagcgatacttagctcccaaaggatttggaggggttcaggtttcctcaccc
aatgaaaatgcggtaattaataatccttcaagaccttggtgggaaaggtaccaaccagtt
agctacaagttatgtacaagatcaggaaatgagaatgaattcaaagacatggtgactaga
tgtaacaacgttggtgtccgtatttatgtggatgctgtaattaatcatatgtgtggaaat
ggtgtggctgcaggaacgagcagtacttgtgggagttacttcaaccctggaactgaggat
tttccagcagtcccgtactctggttgggattttaatgatggtaaatgtaaaactagaagt
ggagaaattgagagctataatgatgcttctcaggtccgagattgtcgtctggttggtctt
cttgatcttgcactggagaaagattatgtgcgctccacaattgctgaatatctaaaccgt
ctcattgacattggtgtagcagggttcagaattgatgccgctaagcacatgtggcctgga
gacatgaaggcaattttggataaactgcataatctaaacaaaagatggttccctgcagga
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcagt
gagtactttggaaatggccatgtgacagaatttaaatatggtgcaaaactaggcacagtt
ctgcgcaagtggaatggagagaagatgtcttacttaaagaactggggagaaggctggggt
ttcatgccttctgacagagcacttgtctttgttgataaccatgacaatcagcgagggagt
ggagctgggggagcatctattcttacattctgggaccctagactgtacaaaatgggagtt
ggatttatgctcgctcatccctatggatttacacgagtaatgtcaagctaccgttggcca
agacattttgaaaacggaaaagatgttaataattggattgggccaccaaataataatgga
gtcattaaagaagttactattaatccagatactacttgtggcaatgactgggtctgtgaa
catcgatggcgtcaaataaggaacatggttgtgttccgcaatgtagttgatggccaacct
tttacaaactggtgggataatggtagcaaccaagtagcttttggaagaggaaacagagga
ttcattgtctttaacaatgatgactgggcattatcttcaactttgcaaactggtcttcct
gctggtacatattgtgatgtcatttctggagataaaattggtaactattgtacaggaatt
aaaatctatgtttccggtgatggcaatgctaacttttctattagtaactctgctgaagat
ccatttattgcgattcatgctgaatctaaattataa

DBGET integrated database retrieval system