KEGG   Orcinus orca (killer whale): 101288861Help
Entry
101288861         CDS       T05247                                 

Gene name
DPM1
Definition
(RefSeq) dolichol-phosphate mannosyltransferase subunit 1
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00510  N-Glycan biosynthesis
oor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    101288861 (DPM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:oor01003]
    101288861 (DPM1)
Enzymes [BR:oor01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     101288861 (DPM1)
Glycosyltransferases [BR:oor01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   101288861 (DPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_21 Glyco_tranf_2_4
Motif
Other DBs
NCBI-GeneID: 101288861
NCBI-ProteinID: XP_004282950
LinkDB All DBs
Position
Unknown
AA seq 260 aa AA seqDB search
MASGEASGPSTGSPREPEPRTPRQDKYSVLLPTYNERENLPLIVWLLVKSFSESGFNYEI
IIIDDGSPDGTRDVAEQLEKIYGSDKILLRPREQKLGLGTAYIHGVKHATGNYIIIMDAD
LSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGGVYGWDLKRKIISRGANFITQILLRPGA
SDLTGSFRLYRKEVLQKLIEKCVSKGYVFQMEMIVRARQLNYTVGEVPISFVDRVYGESK
LGGNEIVSFLKGLLTLFATT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcctccggggaagcgagtggaccgtctactgggtctccgcgggagccagagccgcgc
accccgcgacaagacaagtattcggtgcttttgcccacctacaacgagcgcgagaaccta
ccgctcattgtgtggctgctggtgaagagcttctccgagagtggcttcaactatgaaatt
ataatcatagatgatggaagcccagatggaacaagggatgttgctgaacagttggagaag
atctatgggtcagacaaaattcttctaagaccacgggagcaaaagttgggactaggaact
gcatatattcatggggtgaaacatgccacaggaaactacataatcatcatggatgctgat
ctctcacaccatccaaaatttattcctgaattcattaggaagcaaaaggagggtaatttt
gacattgtctctggaactcgctacaaaggaaatggaggtgtatatggctgggatttgaaa
aggaaaataatcagccgtggggccaattttataactcagatcttgctgagaccaggagcg
tctgatttaacaggaagtttcaggttataccgaaaagaagttttacagaaattaatagaa
aaatgtgtttctaaaggctacgtcttccagatggagatgattgttcgggcaagacagctg
aattatactgttggcgaggttccaatatcatttgtggatcgtgtttatggtgaatccaag
ttgggaggaaatgaaatagtctctttcttgaaaggactattgaccctctttgctactaca
taa

DBGET integrated database retrieval system