KEGG   Orcinus orca (killer whale): 101288921Help
Entry
101288921         CDS       T05247                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor00052  Galactose metabolism
oor00500  Starch and sucrose metabolism
oor01100  Metabolic pathways
oor04142  Lysosome
Brite
KEGG Orthology (KO) [BR:oor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101288921 (GAA)
   00500 Starch and sucrose metabolism
    101288921 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101288921 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oor04147]
    101288921 (GAA)
Enzymes [BR:oor01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101288921 (GAA)
Exosome [BR:oor04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101288921 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101288921
NCBI-ProteinID: XP_012390494
LinkDB All DBs
Position
Unknown
AA seq 943 aa AA seqDB search
MMRWPPRSCPLLGVCALVSLAILGHILLHDFDVVPQELHSFSQEEIYPARQPRASGQGPQ
PVPRRHGSPREAPTQCDLPPDGRFDCAPDKAITQEQCEARGCCYMPARWPPGTQMGQPWC
FFPPNYPSYRLENLTTTKTGYTATLIRATPTFFPKDIMTLRLDVLVETESRLHFTIKDPT
NQRYEVPLETPRVRSQAPSTLYSVEFSEEPFGVIVRRKLDGRVLLNTTVAPLFFADQFLQ
LSTSLPSQHITGLAEHLGPLMLSTNWTKVTLWNRDVAPTPDVNLYGSHPFYLGLEDGGLA
HGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVRQYLDIVGYPFMPPYW
GLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDARRDFTFNKDGFGDFPAM
VQELHQSGRRYIMIVDPAISSSSPAGTYRPYDEGLRRGVFITNETGQPLIGQVWPGLTAF
PDFTNPEALDWWQDMVAEFHAQVPFDGMWIDMNEPSNFVRGSVDGCPNSNLENPPYVPGV
VGGTLRAATICASSHQFLSTHYDLHNLYGLTEAFASHRALVKARGMRPFVISRSTFAGHG
QYAGHWTGDVWSSWEQLSYSVPEILLFNLLGVPLVGADICGFLGNTSEELCVRWTQLGAF
YPFMRNHNGLNSLPQEPYRFSETAQQAMRKAFALRYMLLPYLYTLFHGAHVRGETVARPL
FLEFPEDPRTWTVDRQLLWGEALLITPVLKAGKVEVTGYFPRSTWYDLRTVPVEAFGSLP
PPAPLMSAIHSEGQWVTLSAPLDTINLHIRAGHIIPMQGPGLTTTESRKKPMALAVALTA
SGEARGELFWDDGESLGVLDRGAYTQVTFLATNNTIVNQLVHVSSEGADLQLRKVTVLGV
ATAPQQVVCNGVSVSNFTYGPDTETLDIPVSLTMGEQFLISWS
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggtggccaccccgttcctgccccttgctgggggtctgcgccctagtctccttg
gccatcctggggcacatcctgcttcatgacttcgacgtggtcccccaagagctgcacagc
ttctcccaagaggagatttacccagctcgccagcccagagccagcggccaagggccccag
cctgtcccacggcgccacggcagccccagggaagcacccacacagtgcgacctgcccccc
gacggccgcttcgactgcgccccagacaaggccatcacccaggagcagtgtgaggcccgg
ggctgctgctacatgcctgcaaggtggcctccgggcacccagatggggcagccctggtgc
ttcttccctcccaactatcccagttacaggctggagaacctgaccaccaccaagacgggc
tacacggccaccctgatccgtgccaccccgaccttcttccccaaggacatcatgaccttg
cggctggacgtgctggtggagactgagagccggctccacttcacgatcaaagatcccacc
aaccagcgctatgaggtgcccttggagaccccacgtgtccgcagccaggcgccgtccacg
ctctacagcgtggagttctcagaggagcccttcggggtgatcgtgcggcggaagctggat
ggacgggtgctgctgaacaccacagtggcccccctgttcttcgccgaccagtttctgcag
ctgtctacctccctgccatcccagcacatcacgggcctcgccgaacacctcgggcccctg
atgctcagcaccaactggaccaaggtcactctctggaacagggacgtcgcccctacgccc
gacgtgaacctatatggatctcaccctttctacctgggcctggaggatggcggtttagct
cacggggtcttcctgctgaacagcaatgccatggatgtggtcctgcagcccagcccggcc
ctcagctggaggtcgacaggcgggatcctggatgtgtacatcttcctgggtccggagccc
aagagcgtggtgcggcagtacctggacatcgtgggctacccattcatgccaccgtactgg
ggcctgggcttccacctgtgccgctggggctactcctccaccgccatcacccgccaggtt
gtggagaacatgaccagggcacacttccctctggacgtccagtggaatgacctggactac
atggacgccaggcgggacttcactttcaacaaggacggctttggggacttcccggccatg
gtgcaggagctccaccaaagtggccggcggtacatcatgattgttgatcctgccatcagc
agctccagccctgccgggacctatcgaccctacgacgagggtctgaggcggggggtcttc
atcaccaatgagactgggcagccgctgattgggcaggtgtggcccggactcaccgccttc
cctgacttcaccaaccccgaggcccttgactggtggcaggacatggtggccgagttccac
gcccaggtgccctttgacggcatgtggatcgacatgaacgagccatccaattttgtgagg
ggctcagtggatggctgccccaacagcaacctggagaacccgccctacgtgccaggggtg
gttggcgggaccctccgggcagccaccatctgcgcctccagccaccagttcctgtccaca
cactacgacctgcacaacctgtacggcctgaccgaagccttcgcctcccacagggctctg
gtaaaggctcggggcatgcgcccctttgtgatctctcgctccacctttgccggccacggc
cagtacgccggccactggacaggggatgtgtggagcagctgggagcagctttcgtactcc
gtgccagaaatcctgctcttcaatctgctgggggtgcccctggtgggggccgacatctgt
ggcttcctgggcaacacttcggaggagctgtgtgtgcgctggacccagctgggggccttc
taccccttcatgcggaaccacaatggcctgaacagcctgccgcaggagccgtacaggttc
agcgagacggcacagcaagccatgaggaaggcctttgccctgcgctacatgctgctgccc
tatctctacacgctgttccatggggcccacgtcagaggcgagaccgtggcccggcccctc
ttcttggagttccccgaggatccccgcacctggacagtggaccgccagctcctgtggggg
gaggctctgctcatcaccccggtgcttaaggctgggaaggttgaggtcactggctacttt
ccccgcagcacgtggtatgacctgcggacggtgccagtggaggcctttggcagcctccca
ccccctgcacccctcatgtctgccatccacagcgaggggcagtgggtgacactgtccgcc
ccactggacaccatcaacctccacatccgggccgggcacatcatccccatgcagggccct
ggcctcacaaccacagagtcccgcaagaagcccatggccctggctgtggccctgactgca
agtggggaggcccgaggggagctgttctgggacgatggggagagcctaggagtgctggac
cgcggggcgtacacgcaggtcaccttcctggccacgaacaacaccatcgtgaaccagctg
gtgcacgtgagcagtgagggggctgacctgcagctgaggaaggtgaccgtcctgggggtg
gccacagccccccagcaagtcgtctgcaatggcgtttctgtatccaacttcacctacggc
cctgacacggagaccctggacatccctgtctcgctgacgatgggagagcagttcctcatc
agttggtcttaa

DBGET integrated database retrieval system