KEGG   Orcinus orca (killer whale): 101289351
Entry
101289351         CDS       T05247                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04010  MAPK signaling pathway
oor04060  Cytokine-cytokine receptor interaction
oor04068  FoxO signaling pathway
oor04144  Endocytosis
oor04218  Cellular senescence
oor04350  TGF-beta signaling pathway
oor04380  Osteoclast differentiation
oor04390  Hippo signaling pathway
oor04520  Adherens junction
oor04659  Th17 cell differentiation
oor04926  Relaxin signaling pathway
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor05142  Chagas disease
oor05161  Hepatitis B
oor05166  Human T-cell leukemia virus 1 infection
oor05200  Pathways in cancer
oor05202  Transcriptional misregulation in cancer
oor05210  Colorectal cancer
oor05212  Pancreatic cancer
oor05220  Chronic myeloid leukemia
oor05225  Hepatocellular carcinoma
oor05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101289351 (TGFBR2)
   04350 TGF-beta signaling pathway
    101289351 (TGFBR2)
   04390 Hippo signaling pathway
    101289351 (TGFBR2)
   04068 FoxO signaling pathway
    101289351 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101289351 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101289351 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    101289351 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101289351 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101289351 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101289351 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101289351 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101289351 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    101289351 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101289351 (TGFBR2)
   05212 Pancreatic cancer
    101289351 (TGFBR2)
   05225 Hepatocellular carcinoma
    101289351 (TGFBR2)
   05226 Gastric cancer
    101289351 (TGFBR2)
   05220 Chronic myeloid leukemia
    101289351 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101289351 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101289351 (TGFBR2)
   05161 Hepatitis B
    101289351 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101289351 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oor01001]
    101289351 (TGFBR2)
Enzymes [BR:oor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101289351 (TGFBR2)
Protein kinases [BR:oor01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   101289351 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101289351
NCBI-ProteinID: XP_004279728
LinkDB
Position
Unknown
AA seq 567 aa
MGRGLLGGLWPLHIVLWTRIASTIPPHVPKSVNSDMMVTDDNGAVKLPQLCKFCDVRLST
CDSQKSCWSNCSITAICEKPQEVCVAVWRKNDENITLETVCHDPKIAYHGFVLDDAASSE
CIMKEKKGSGETFFMCSCSSEECNDHIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAI
AVIVTFYCYRVHRQQKLSPAWDSGKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLRQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRRLGGSLARGIAH
LHSDHTLCGRPKMPIVHRDLKSSNILVKGDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCSAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCETLAECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSSSEEKIPEDGSLNTTK
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgggccgggggctgcttgggggcctgtggccgctgcacatcgtcctgtggacacgcatc
gccagcacgatcccgcctcacgttcccaagtcggttaacagtgacatgatggtcactgac
gacaatggtgccgtcaagttgccgcagttgtgtaaattctgtgatgtgagattgtccacc
tgtgacagccagaagtcctgctggagcaactgcagcatcacggccatctgtgagaagccg
caagaggtctgcgtggctgtctggagaaagaatgatgagaacatcacactggagacggtc
tgccatgaccccaagattgcctaccatggatttgtccttgacgacgctgcttcttcagag
tgtattatgaaggaaaaaaaggggtctggagagactttcttcatgtgttcctgcagctcc
gaagagtgcaacgaccacatcatcttctccgaagaatacgccaccaacaaccccgacttg
ctgttggtcatcttccaagtgacaggtgtcagcctcctgccgccactgggcatcgccatt
gctgtcattgtcaccttctactgctaccgcgtccaccggcagcagaagctgagcccggcc
tgggactcgggcaagccgcgcaagctgatggagttcagtgagcacctggccatcatcctg
gaggatgaccgctccgacatcagctccacctgcgccaacaacatcaatcacaacacggag
ttgctgcccattgagctggacaccctggtgggcaaagggcgcttcgccgaggtctacaag
gccaagctgaggcagaacacgtctgagcagtttgagaccgtggccgtcaagatcttcccc
tatgaagaatatgcctcctggaagacggagaaggacatcttctcggacatcaacctcaag
cacgagaacatcctgcagttcctgacagctgaggagcgcaagacggagctgggcaagcag
tactggctgatcaccgccttccacgccaagggcaacctgcaggagtacctgacgcgccac
gtcatcagctgggaggacctgcgcaggctgggcggctcgctggcccgtggcatcgcacac
ctacacagcgaccacacgctgtgcggccgacccaagatgcccatcgtgcacagggacctc
aagagctccaacatcctggtcaagggagacctcacctgctgcctctgtgacttcggcctc
tccctgcggctggaccccactctgtctgtggatgacctggccaacagtgggcaggtggga
acggcgagatacatggctccagaggtcctagagtccaggatgaatctggagaatgtcgag
tccttcaagcagacagatgtctactccatggccctggtgctctgggagatgacgtctcgc
tgcagcgcagtgggagaagtgaaggattatgagcctccattcggttccaaggtgcgggag
catccctgtgtcgaaagcatgaaggacaacgtgttgagagatcgaggacgacccgaaatc
ccaagctcctggctcaaccaccagggcatccagatggtgtgtgagacgctggccgagtgc
tgggaccacgaccccgaggcccggctcacggcacagtgtgtggccgagcgcttcagtgag
ctggagcatctggacagactctcgggcaggagcagttcagaggagaagattcccgaagac
ggctccctgaacactaccaaatag

DBGET integrated database retrieval system