KEGG   Orcinus orca (killer whale): 101289422Help
Entry
101289422         CDS       T05247                                 

Gene name
TSPAN5
Definition
(RefSeq) tetraspanin-5
  KO
K17345  tetraspanin-5
Organism
oor  Orcinus orca (killer whale)
Brite
KEGG Orthology (KO) [BR:oor00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oor04147]
    101289422 (TSPAN5)
Exosome [BR:oor04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101289422 (TSPAN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 101289422
NCBI-ProteinID: XP_004277045
LinkDB All DBs
Position
Unknown
AA seq 268 aa AA seqDB search
MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGIAFLGIGLWAWNEKGVLSNISSITDLGGFD
PVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIK
DQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERC
GVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIF
IGIALLQIFGICLAQNLVSDIEAVRASW
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggaagcattacaagggtcctgaagtcagttgttgcatcaaatatttcatattt
ggcttcaatgtcatattttggtttttgggaatagcatttcttggaattggactgtgggcg
tggaatgaaaaaggagttctatccaacatctcttccatcaccgatcttggcggctttgac
ccagtttggctcttcctcgtggtaggaggagtgatgttcattctgggatttgctgggtgc
attggagctctacgggaaaacactttccttctcaagtttttttctgtcttcctgggaatc
attttcttcctggagctcactgccggggttctggcattcgttttcaaagactggatcaaa
gaccagctgtatttctttataaacaacaacatcagagcgtacagggatgacattgatttg
caaaacctcatagacttcacccaggaatattggcagtgctgtggggcttttggagctgat
gattggaacctaaatatttacttcaattgcacagattccaatgcaagtcgagagcgatgc
ggcgtgcccttctcctgctgtactaaagaccccgcagaagatgtcatcaacactcagtgt
ggctatgatgccaggcaaaaaccagaagtcgatcagcagattgtaatctacacgaaaggc
tgtgtgccccagtttgagaagtggttgcaggacaacttaaccattgtggctggtattttc
ataggcattgcattgctacagatttttgggatctgcctggcccagaacctggtgagtgat
attgaagctgtcagggctagctggtag

DBGET integrated database retrieval system