KEGG   Orcinus orca (killer whale): 101289847Help
Entry
101289847         CDS       T05247                                 

Gene name
CASP3
Definition
(RefSeq) caspase-3
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor01524  Platinum drug resistance
oor04010  MAPK signaling pathway
oor04115  p53 signaling pathway
oor04210  Apoptosis
oor04215  Apoptosis - multiple species
oor04650  Natural killer cell mediated cytotoxicity
oor04657  IL-17 signaling pathway
oor04668  TNF signaling pathway
oor04726  Serotonergic synapse
oor04932  Non-alcoholic fatty liver disease (NAFLD)
oor04933  AGE-RAGE signaling pathway in diabetic complications
oor05010  Alzheimer disease
oor05012  Parkinson disease
oor05014  Amyotrophic lateral sclerosis (ALS)
oor05016  Huntington disease
oor05132  Salmonella infection
oor05133  Pertussis
oor05134  Legionellosis
oor05145  Toxoplasmosis
oor05146  Amoebiasis
oor05152  Tuberculosis
oor05160  Hepatitis C
oor05161  Hepatitis B
oor05162  Measles
oor05163  Human cytomegalovirus infection
oor05164  Influenza A
oor05165  Human papillomavirus infection
oor05167  Kaposi sarcoma-associated herpesvirus infection
oor05168  Herpes simplex virus 1 infection
oor05169  Epstein-Barr virus infection
oor05170  Human immunodeficiency virus 1 infection
oor05200  Pathways in cancer
oor05203  Viral carcinogenesis
oor05205  Proteoglycans in cancer
oor05206  MicroRNAs in cancer
oor05210  Colorectal cancer
oor05222  Small cell lung cancer
oor05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101289847 (CASP3)
   04668 TNF signaling pathway
    101289847 (CASP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101289847 (CASP3)
   04215 Apoptosis - multiple species
    101289847 (CASP3)
   04115 p53 signaling pathway
    101289847 (CASP3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101289847 (CASP3)
   04657 IL-17 signaling pathway
    101289847 (CASP3)
  09156 Nervous system
   04726 Serotonergic synapse
    101289847 (CASP3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101289847 (CASP3)
   05206 MicroRNAs in cancer
    101289847 (CASP3)
   05205 Proteoglycans in cancer
    101289847 (CASP3)
   05203 Viral carcinogenesis
    101289847 (CASP3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101289847 (CASP3)
   05222 Small cell lung cancer
    101289847 (CASP3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101289847 (CASP3)
   05012 Parkinson disease
    101289847 (CASP3)
   05014 Amyotrophic lateral sclerosis (ALS)
    101289847 (CASP3)
   05016 Huntington disease
    101289847 (CASP3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101289847 (CASP3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101289847 (CASP3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101289847 (CASP3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101289847 (CASP3)
   05133 Pertussis
    101289847 (CASP3)
   05134 Legionellosis
    101289847 (CASP3)
   05152 Tuberculosis
    101289847 (CASP3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101289847 (CASP3)
   05162 Measles
    101289847 (CASP3)
   05164 Influenza A
    101289847 (CASP3)
   05161 Hepatitis B
    101289847 (CASP3)
   05160 Hepatitis C
    101289847 (CASP3)
   05168 Herpes simplex virus 1 infection
    101289847 (CASP3)
   05163 Human cytomegalovirus infection
    101289847 (CASP3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101289847 (CASP3)
   05169 Epstein-Barr virus infection
    101289847 (CASP3)
   05165 Human papillomavirus infection
    101289847 (CASP3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101289847 (CASP3)
   05145 Toxoplasmosis
    101289847 (CASP3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101289847 (CASP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oor01002]
    101289847 (CASP3)
Enzymes [BR:oor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     101289847 (CASP3)
Peptidases and inhibitors [BR:oor01002]
 Cysteine peptidases
  Family C14: caspase family
   101289847 (CASP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 SICA_beta
Motif
Other DBs
NCBI-GeneID: 101289847
NCBI-ProteinID: XP_004281784
LinkDB All DBs
Position
Unknown
AA seq 275 aa AA seqDB search
MENNENSVDSKSIKTSETKILHGSKSMDSGISLDYSYKMDYPEMGLCIIINNKNFHESTG
MACRSGTDVDAANLWETFTNLKYEVRNKNDLTCEEILELMYNVSKEDHSKRSSFICVLLS
HGEEGKIFGTNGPVDLKKLAGFFRGDCCISLTGKPKLFVIQACRGTELDCGIETDSGVED
DMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYAHKLELMHILTRVN
RKVAIEFESFSNDSTFHAKKQIPCIVSMLTKELYF
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaatgaaaattcagtggattcaaaatccattaaaacttcagagacaaagatc
ttacatggaagcaaatcaatggactctggaatatccttggactatagttacaaaatggat
tatcctgaaatgggtttatgtataataattaataataagaactttcatgaaagtactggg
atggcatgtcggtctggtacagacgtagatgcagcaaacctctgggaaaccttcacgaac
ttgaaatatgaagttaggaataaaaatgatcttacatgtgaagaaattttggaattaatg
tacaatgtttctaaagaagatcacagcaaaaggagcagttttatttgcgtgcttctaagc
catggcgaggaaggaaaaatttttggaacaaatggacctgtcgatctgaaaaaattagca
ggtttcttcagaggggattgttgtataagcctaactggcaaacctaagcttttcgttatt
caggcttgccgaggcacagaactggactgtggtattgagacagacagtggtgttgaggat
gacatggcctgtcagaaaataccagttgaggcagacttcttgtatgcatattctacagca
cctggttactattcctggcgaaattcaaaggacggatcctggttcatccagtcactttgt
gcaatgctgaaacagtacgctcacaagcttgagcttatgcatattctcactcgggttaac
cgaaaggtagcaatagaattcgagtccttttccaatgattctacttttcatgcaaagaaa
cagattccttgtattgtgtctatgctcacaaaagaactgtatttttaa

DBGET integrated database retrieval system