KEGG   Orcinus orca (killer whale): 101290226Help
Entry
101290226         CDS       T05247                                 

Gene name
FAN1
Definition
(RefSeq) fanconi-associated nuclease 1
  KO
K15363  fanconi-associated nuclease 1 [EC:3.1.21.- 3.1.4.1]
Organism
oor  Orcinus orca (killer whale)
Pathway
oor03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:oor00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    101290226 (FAN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oor03400]
    101290226 (FAN1)
Enzymes [BR:oor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     101290226 (FAN1)
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.-  
     101290226 (FAN1)
DNA repair and recombination proteins [BR:oor03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     101290226 (FAN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VRR_NUC zf-TRAF zf-WRNIP1_ubi PRP21_like_P
Motif
Other DBs
NCBI-GeneID: 101290226
NCBI-ProteinID: XP_004278403
LinkDB All DBs
Position
Unknown
AA seq 1023 aa AA seqDB search
MMSVGKSSKKRPRSLSSSKTKKNESNSITAFFNNVPPVKLACPICSKMVPRYDLNRHLDE
MCASNGDITPADPGHADLSSNVSTVDLTNTALEDVAPEKSSPSKINLTPGQSDSAKMGIK
QQTSPYFKSNGDAVCRNQDGLRHHNVKVIPLGSLSSKLSRRYIKAKRSIGKSEGFASQSP
QSFSSTGVRSLVDQCSEMEGQDQLLENSSQKENMFACNSLEEPSTPEHTVGGSTIMEAES
LRAAQECGRSTLTPTFSDNAPVLPSPDLTLGHKLKSASEDHLAKQESIKGTDDKGVENCE
AGGCEEVKMTFVSQAATQSSHWEAKSHNSTHDASIWSDSQALPPEGDSGLKNESTDRIPL
EQGSSCDVSRVTSPAPPDHPYYLRSFLVVLKAVFENEEDRMLFDEHEKGIITKFHQLSAS
GQKLYVRLFQRKFGWIKMNKLEYEEISADLTPVVRELTHAGFLQTESELQELSEVLELLS
APELKALAKTFHLVNPNGQKQQLVNAFLKLAKQPSVCTWRKNQPGIGAVILKRAKDWAGQ
SLRVCRDPRAVFSRVLLLFSLTHEVEEEEAACGGQGQLSTVLLVNLGRMEFPRYTVSRKT
QIFQDREDLIRYAAAAHMLNDISTAMASGAWEEARELARCAKQDWDGLKGHPSLRYHEKL
PLFLRCFTVGWVYTRILSRTVEILQRLHMYQEAVKELENLLSQKVYCPDSRGRWWDRLAL
NLHQHLKRLEPAIKCITAGLADPDVRTGHRLSLYQRAVRLRASPSCQKYAHLFRQLPEVT
VGDVKHVTVTGRLCPQPGPGKSVFVLEAGGTAPATVLCSVEELALAHYRRCGFDQGIHGE
GSTFSTLYGLLLWDVIFMDGIPDAFRNAYQAAPLDLCTDSFFASRAPAIETRLRQIHGAS
AESLRAWVAAAWQAQEGRVASLVSWDRFASLRQAQDLVSCLGGPILSGVCRRLAMDFRHC
RGGLPDLVVWSSQSHRVKLVEVKGPSDRLSQKQMIWLDELHRLGADVEVCHVAAVGAKSR
GPN
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctgtagggaaatcctcaaaaaaaagacctcgaagtttatcaagcagcaaaact
aaaaaaaatgaatctaactctattactgcgttttttaacaatgtaccacctgttaaactt
gcctgccccatttgtagtaaaatggtgccaagatatgacctaaaccgtcaccttgatgaa
atgtgtgctagcaacggtgacatcactccagctgaccctgggcatgctgacttaagttca
aatgtgtccacagtagatttgaccaatactgccttagaagatgtagcgcctgagaagtcg
tcaccatcaaagatcaacttaacccctggccaaagtgactcagcaaaaatgggcataaaa
cagcagaccagcccctattttaagagtaatggggacgcagtgtgcagaaatcaagatggg
ctgaggcatcacaacgtgaaagtcatccctctggggagcctgtcatctaaattgtccaga
agatacataaaggctaaaagatcaataggtaagagtgagggattcgccagtcagagtcca
cagagtttctcgtccacaggggtgaggagcctggtggatcagtgttcagagatggaaggc
caggatcagcttttggagaacagttctcaaaaggaaaacatgtttgcctgtaattctctg
gaggaaccaagcactcccgaacatactgtgggaggctctacaataatggaagctgaaagc
ctaagggctgcacaggaatgtgggagatcaactctcacccccaccttctcagataatgct
cccgtgttaccttcaccagatttaactcttgggcataaattaaagtctgcttcagaggac
catcttgcaaagcaggagagtatcaaaggaacagatgataaaggtgttgaaaactgtgaa
gcaggtggttgtgaagaggtaaaaatgacttttgtttcacaagctgcaacccagtcgtca
cattgggaggcaaaatctcataattctacacacgatgcttctatatggagtgacagccaa
gcacttcctccagaaggtgacagtggcttaaagaatgaaagcactgaccgaattcctttg
gagcaggggtcaagctgtgatgtttcccgtgtaacaagtccagcaccaccggaccatcct
tactaccttcggagtttcctcgtggtgctgaaagccgtgtttgagaatgaagaagacagg
atgctctttgatgagcacgagaagggcattataactaaatttcatcaattatcagctagc
ggtcagaagttatatgtcagactttttcaacgtaaattcggctggattaagatgaacaaa
ctggaatatgaagagatctccgctgacttaaccccggtggttagagagttgacgcatgca
ggcttcctgcagacagagtctgagttgcaagaactgtctgaggtgctcgagctcctttct
gctccggaactgaaagccctggcaaagaccttccacttggtgaatcccaatgggcagaag
cagcagctggtgaatgcgtttctcaaattggccaaacagccttcagtctgcacttggcgc
aagaatcagcctggcattggtgcagtgattttgaaaagagctaaagactgggcgggacag
tctctgagagtgtgtagagacccccgggctgtgttctcccgggtcctgctgctgttttca
ctgacccacgaggtggaagaggaggaggcggcctgtggtgggcagggccagctttctacg
gtgctgctggtcaaccttggccgcatggagtttcccaggtataccgtcagtcggaaaacc
caaatcttccaggatagagaggatctcatcaggtacgcagcggccgcgcacatgctgaac
gacatctccaccgcgatggccagcggggcctgggaggaagccagggagctcgctcggtgt
gcaaagcaggattgggacggactgaaaggccacccgtccctgagataccacgagaaactg
ccactctttctccggtgttttaccgttggttgggtttatacgaggattttgtcccgaacc
gttgaaatactgcagagacttcacatgtaccaggaagccgtcaaggagcttgaaaacctt
ttgtcccagaaagtgtactgtcctgacagcagaggtcggtggtgggaccggctggctctc
aacttgcaccagcacctgaagcgcctggagccggccatcaagtgcatcacagcagggctg
gcggatccggacgtgcggacaggccaccgcctctcgctgtatcagagggccgtgcgcctg
cgggcctctcccagctgccagaagtacgcgcacctcttccgtcagctcccggaagtcact
gtgggtgacgttaaacatgtgaccgtcacgggccggctctgcccgcagcctgggccgggc
aagtctgtcttcgtgctggaggctggggggaccgcccctgccaccgtcctgtgctctgtg
gaggagctggcactggcccattacagacgctgtggcttcgaccaggggattcacggggaa
gggtccaccttcagcacgctgtacggcctcctcctatgggatgtcatcttcatggacggg
ataccagacgccttcagaaacgcctaccaggcggccccgctggacctctgcacggacagc
ttcttcgccagcagagcaccggccatcgagacccggctgcgacagattcacggtgcctcc
gcggagagcctgcgggcctgggtggcagccgcgtggcaggcccaggaaggcagggtggcc
tcccttgtcagctgggatcgctttgcttctcttcggcaagcccaggatcttgtgtcctgc
ctggggggccccatcctcagtggtgtgtgccggcgcctggccatggacttccgacactgc
cgagggggcctccctgacctggtggtgtggagctcccaaagtcaccgcgttaagctggtg
gaagtgaagggccccagtgaccgtctttcgcagaagcagatgatctggctggatgagctg
caccggctgggggcggacgtggaggtctgccatgtggctgcagtcggagccaagagcagg
ggccccaactga

DBGET integrated database retrieval system