KEGG   Orcinus orca (killer whale): 101290331
Entry
101290331         CDS       T05247                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04060  Cytokine-cytokine receptor interaction
oor04151  PI3K-Akt signaling pathway
oor04630  JAK-STAT signaling pathway
oor04640  Hematopoietic cell lineage
oor04657  IL-17 signaling pathway
oor04658  Th1 and Th2 cell differentiation
oor04659  Th17 cell differentiation
oor04660  T cell receptor signaling pathway
oor04664  Fc epsilon RI signaling pathway
oor04672  Intestinal immune network for IgA production
oor05140  Leishmaniasis
oor05200  Pathways in cancer
oor05310  Asthma
oor05320  Autoimmune thyroid disease
oor05321  Inflammatory bowel disease
oor05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101290331 (IL4)
   04151 PI3K-Akt signaling pathway
    101290331 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101290331 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101290331 (IL4)
   04660 T cell receptor signaling pathway
    101290331 (IL4)
   04658 Th1 and Th2 cell differentiation
    101290331 (IL4)
   04659 Th17 cell differentiation
    101290331 (IL4)
   04657 IL-17 signaling pathway
    101290331 (IL4)
   04664 Fc epsilon RI signaling pathway
    101290331 (IL4)
   04672 Intestinal immune network for IgA production
    101290331 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101290331 (IL4)
  09163 Immune disease
   05310 Asthma
    101290331 (IL4)
   05320 Autoimmune thyroid disease
    101290331 (IL4)
   05321 Inflammatory bowel disease
    101290331 (IL4)
   05330 Allograft rejection
    101290331 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101290331 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oor04052]
    101290331 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:oor00536]
    101290331 (IL4)
Cytokines and growth factors [BR:oor04052]
 Cytokines
  Interleukins
   101290331 (IL4)
Glycosaminoglycan binding proteins [BR:oor00536]
 Heparan sulfate / Haparin
  Cytokines
   101290331 (IL4)
SSDB
Motif
Pfam: IL4 DUF4798
Other DBs
NCBI-GeneID: 101290331
NCBI-ProteinID: XP_004279949
LinkDB
Position
Unknown
AA seq 133 aa
MGLTSQLIPMLVCLLACTSNFVHGHKCDVTLQEIIKTLNILTARKNLCMELPVEDVFATT
KNTTEKETFCRAGTVLRHIYRYHKCFNKPLSGLHRNLSSMANMTCSVNEAKKSTLKDFLE
RLKMIMKEKYSKC
NT seq 402 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgatcccaatgctagtctgcttactggcatgtaccagcaac
ttcgtccatggacacaagtgcgatgttaccttacaagagatcatcaaaacgctgaacatc
ctcacagcaagaaagaacttgtgcatggagctgcctgtagaagacgtctttgccaccaca
aagaacacaactgagaaggaaactttctgcagggccgggactgtgcttcggcatatctac
agataccacaagtgcttcaacaaacccctgagtggacttcacaggaacctcagcagcatg
gcaaacatgacctgttctgtgaatgaagccaagaagagtacgttgaaagacttcttggaa
aggctaaagatgattatgaaggagaaatactcaaagtgttga

DBGET integrated database retrieval system