KEGG   Orcinus orca (killer whale): 105748918
Entry
105748918         CDS       T05247                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04060  Cytokine-cytokine receptor interaction
oor04151  PI3K-Akt signaling pathway
oor04210  Apoptosis
oor04630  JAK-STAT signaling pathway
oor04640  Hematopoietic cell lineage
oor05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    105748918 (IL3RA)
   04151 PI3K-Akt signaling pathway
    105748918 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105748918 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105748918 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    105748918 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105748918 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oor04050]
    105748918 (IL3RA)
   04090 CD molecules [BR:oor04090]
    105748918 (IL3RA)
Cytokine receptors [BR:oor04050]
 Interleukin receptor families
  IL3 receptor family
   105748918 (IL3RA)
CD molecules [BR:oor04090]
 Proteins
  105748918 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind Y_Y_Y InlK_D3
Other DBs
NCBI-GeneID: 105748918
NCBI-ProteinID: XP_012394742
LinkDB
Position
Unknown
AA seq 384 aa
MAFVWLAVFLVPVSGLLPPDHDPYPIDISDPDPPIKNLRMEPERKRLTWDLHGNVSEIMC
FINSKAFTKARKRTYCSIPDLSCQATNYSIRVTKGQPFSTWIQYPSKEGNPRAAAENLTC
WVHDVDFLTCSWAVGREAPRDVQYHLYLENLDSYEKWPCSQYRADEQGTNVQCRFHNISV
LSKDQTRFLVNGTGSGSKIPCSETSDRLAKIEVLAAPNITSRWCNQSYSFMQWQVRSHLN
DDFKYELQIQKGTELAYKQEIYKAFLELNNPGTYTVQVRARDATFSHYKPWGPWSVPQHF
VCEEGARLPVWLTSLLIALGTLLAMGLVLRFCRFSVMQKLFPPIPHMKDHINGKLQNGRT
MTWDPDQDSQEECPVAEVQVLGET
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggctttcgtctggctggcggtcttcctggtgcccgtctccggcctgctgccaccggac
cacgacccttaccctatagacatttccgatccagacccaccaattaagaacctaaggatg
gagccagaaagaaaaagattgacctgggacctccatggaaacgtttccgaaattatgtgt
ttcatcaattcaaaagctttcactaaggcacggaaaaggacgtattgcagtattcctgac
ttgtcatgccaagctacaaactacagcatcagggtgaccaaaggtcagccattctccacg
tggattcagtatcctagtaaagaagggaatcccagggcggctgcagaaaacctgacctgc
tgggttcacgacgtggatttcctgacgtgcagctgggcggtgggccgggaggccccgagg
gacgtgcagtaccatctctacctggagaacctggactcctatgagaagtggccgtgctcc
cagtacagagcagatgagcaagggacaaacgtccagtgccgttttcacaacatctctgtg
ttatccaaggatcagacgcgtttcctggtgaatggtaccggcagtggttccaaaatcccc
tgctctgaaacgagtgatagactagccaaaatcgaggtattagctgctcccaacatcact
agcaggtggtgtaaccaaagctactcgttcatgcagtggcaagtgaggagtcaccttaat
gatgacttcaagtatgaactgcagatacagaagggtacggagctcgcctacaaacaggag
atctataaagccttcttggagctgaacaatcctgggacctacacggtgcaagtaagggcc
agggatgccaccttctcccattacaaaccttggggcccgtggagtgtcccccaacacttc
gtgtgtgaggagggtgcgcgcctccccgtctggctgacgtctttgctgatcgcgctgggg
acgctgctggctatggggctcgtgctccggttttgcaggttctcggtgatgcagaagctg
ttccctcccatccctcacatgaaagaccacatcaatggcaaacttcagaacggaaggacg
atgacctgggaccccgaccaagacagccaggaggagtgtccagtggccgaggtgcaggtt
ctgggggaaacatga

DBGET integrated database retrieval system