KEGG   Oceanisphaera profunda: CBP31_04385Help
Entry
CBP31_04385       CDS       T04856                                 

Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
opf  Oceanisphaera profunda
Pathway
opf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
opf01100  Metabolic pathways
opf01110  Biosynthesis of secondary metabolites
opf01130  Biosynthesis of antibiotics
opf01230  Biosynthesis of amino acids
Module
opf_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:opf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CBP31_04385
Enzymes [BR:opf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     CBP31_04385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 dNK Thymidylate_kin Cytidylate_kin ABC_tran AAA_22 AAA TsaE AAA_24 AAA_PrkA APS_kinase AAA_16 RNA_helicase Ploopntkinase3 AAA_7 Guanylate_kin AAA_17 CoaE AAA_29 AAA_5 RsgA_GTPase Sigma54_activ_2 IstB_IS21 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: ART81960
UniProt: A0A1Y0D357
LinkDB All DBs
Position
complement(1007921..1008439)
Genome map
AA seq 172 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGKYLAQQLHMEFYDSDHEIERRTGADISWVFDVEGEEGFR
DREEKVINDLSELQGIVLATGGGSIKSKESRNRLSARGIVVYLETPVEKQLARVQKDKRR
PLLQTEEAPEDVLTRLAAERNELYLEIADYVVRTDEQGAKLVAHQIAELIGL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaacgcaatatcttccttgtagggcctatgggtgcgggcaagagcaccatc
ggtaaatacctagcgcagcaactgcatatggagttttatgactccgatcatgagattgag
cgccgtactggtgccgatatcagctgggtatttgatgtcgaaggcgaagaaggcttccgc
gatcgtgaagaaaaagtcatcaacgacctgagtgagttacagggcatagtgttggcgacc
ggcggtggctccatcaaaagcaaagaaagccgtaaccggctgtcggcgcgtggcattgtg
gtctacttagaaacaccggtagagaagcaactggctcgcgtacaaaaagacaaacgtcgc
ccgctactgcaaaccgaagaagcacccgaagacgtgctgacccgattagctgcggaacgt
aacgagttatatctagaaattgccgactacgtagtacgcaccgacgagcaaggcgccaaa
ttggttgcccatcaaatcgccgagctgatcggcctgtaa

DBGET integrated database retrieval system