KEGG   Oceanisphaera profunda: CBP31_04410Help
Entry
CBP31_04410       CDS       T04856                                 

Definition
(GenBank) penicillin-sensitive transpeptidase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
opf  Oceanisphaera profunda
Pathway
opf00550  Peptidoglycan biosynthesis
opf01100  Metabolic pathways
opf01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:opf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CBP31_04410
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CBP31_04410
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:opf01003]
    CBP31_04410
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:opf01011]
    CBP31_04410
Enzymes [BR:opf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     CBP31_04410
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CBP31_04410
Glycosyltransferases [BR:opf01003]
 Polysaccharide
  Bacterial polysaccharide
   CBP31_04410
Peptidoglycan biosynthesis and degradation proteins [BR:opf01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   CBP31_04410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: ART81965
UniProt: A0A1Y0D4C9
LinkDB All DBs
Position
1012277..1014655
Genome map
AA seq 792 aa AA seqDB search
MLKWLIRLFIFGLFLSFCAIAGVFVLYQQVKPELPDVSELKDIRLETPMRIFSQDGELIS
QYGEQRRTPIAIEDMPPMLIDAVLATEDARFYEHPGIDVIGISRAAVVWFTTGEKRQGAS
TITQQVARNFFLTREKTITRKIKEIFLAMHIESLLSKDEILALYLNKIALGHRSHGVGAA
AQVYYGKEVADLTLAEVAMIAGLPQGPSVLNPISNPTRAAERRAVVLGRMLDTGKISRVQ
YNDAMAAPVAARYHGAEITLSAPYIAEMAHQFALSMFGEDAYTKGLKVYTTVQSEEQQAG
TQALVDGLLAYDLRHGYRGATEQLWQGAPWSNEQITEHLASLPSYWPLEPAVVTAVAARS
ATVQVKNKGELTLAWDGLKWARPYIADNRQGHALRQAKDAVAVGDLIWVRPQGEQWMLAQ
LPEINGALAALDPNNGAITSLVGGFNFTLNKFNRAQQAERQMGSNIKPFIYSAALDNGFS
LASMVNDAPINHWDPGTRKSWRPRNSPNVYDGPMRVREALARSKNVVSIRLLQGTGIPIA
LQRLNDLGFDTANIPATDSLALGSPSATPLQMATGYAAFANGGKKVTPFVVQRIEDSNGI
ILYEAEPMVTQVISEETSFLISEALNSAIWGGSSRGRHWNGTGWRAGKALNRQDIAGKTG
TTNESRDAWFSGFTPDRVASAWVGFDDFGRPLGRTAYNANLDGSQVAGGEFGASTALPIW
IGYMKAALAEFPERDRPMPSGLYTATIDPNTGLKTTGKGITEYFVPGTEPKYYSRPETSQ
SFGGTSVTDDLF
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaatggctaattcgcctcttcatattcggtctattcttaagcttttgcgccata
gctggcgtgtttgtgctttatcaacaggtaaagcctgagttgccagatgtatccgaatta
aaagatattcgtcttgaaacgccaatgcgtatcttcagtcaagacggtgagctgatctct
caatatggcgaacaacgccgtacgccaattgcgattgaagacatgccaccgatgttgatt
gatgcggtattagcgaccgaagatgcacgcttttatgagcatccaggcatagatgtgatt
ggtattagtcgtgcggccgtcgtctggtttaccacaggtgaaaaacgccaaggtgccagt
actattacccaacaggtagcgcgaaacttctttttaacccgggaaaaaaccattacccgc
aaaatcaaagaaattttcctcgccatgcacatcgaatctttgttgagcaaagatgaaatt
ttagcgctgtatttaaataaaatagcgctgggtcatcgttctcatggcgtgggtgcggcg
gcacaagtgtattacggcaaagaagtggcggatctgactttggcagaagtggccatgatt
gccggcttgccccaaggcccctccgtattaaaccccatcagcaaccccactcgcgccgca
gagcgcagagccgtggtgctgggccgtatgctagatactggcaaaattagccgcgtacaa
tataacgacgcaatggcggcaccggtggcggcgcgctaccacggcgccgaaattaccctc
agtgcaccttatatcgcagaaatggcgcatcaattcgccttaagcatgtttggtgaagat
gcttataccaaaggtttaaaagtctataccacagtgcaatcagaggagcagcaagcaggc
actcaggcactggtggatggtttgctggcttatgatttacgccacggttatcgcggtgcc
actgagcaattatggcaaggtgcaccttggtcaaacgaacaaatcactgagcatttagca
agcttacccagctattggccattagagccggcggtggttaccgcagtggcggcgcgcagt
gccaccgtgcaagtaaagaataaaggtgagctgaccttggcgtgggatggcctaaaatgg
gcgcgtccttatattgctgacaaccgccaaggccatgccctgcgccaagccaaagatgcc
gtcgcggtgggagatttaatttgggtgcgcccgcaaggtgagcagtggatgctggcgcaa
ttgccagaaattaacggcgcgcttgccgcccttgaccccaataatggcgctattacctcg
ctggtgggtggctttaactttaccttaaataaatttaaccgagcccaacaagcagagcga
caaatgggttctaatattaaaccctttatctactctgcagcactggataatggctttagc
ctagccagcatggtcaatgatgcgcccattaatcactgggatccgggtaccagaaaaagc
tggcggccacgtaactcaccaaacgtctatgacggcccaatgcgcgtgcgcgaagcgcta
gcccgctctaaaaacgtggtctctattcgtctattgcaaggcacgggcattccgatagcc
ctgcaacgcctcaacgacttaggctttgatacggcgaatattcctgccaccgacagttta
gctttgggctcgccctctgccacgcctttgcaaatggctaccggctacgcggcgtttgcc
aatggcggtaaaaaagtcacgccatttgtggtgcagcgcattgaagacagcaacggcatc
atcttgtatgaagccgaacccatggtcacacaggtgatcagcgaagagacctcgttttta
atcagcgaagcgcttaactccgccatttggggcgggagtagccgtggtcggcattggaac
ggtaccggttggcgcgcaggaaaagcgttaaacagacaagatattgccggtaaaactggt
accactaacgaatctcgtgacgcttggttttctggcttcaccccagatcgcgtagccagt
gcttgggtgggctttgatgactttggccgcccattaggccgcacagcttacaacgcaaac
cttgatggcagccaagtagccggcggcgagtttggcgccagtaccgccctgcccatttgg
attggctatatgaaggccgcactcgcagaatttcctgagcgcgaccgacctatgcccagc
ggtttgtataccgcgactatcgaccctaacacgggcttgaagaccacaggcaaagggata
actgagtattttgtgcccggcaccgagcctaaatactacagccgaccagaaaccagccaa
tcctttggtggcaccagcgttacggatgatttgttttaa

DBGET integrated database retrieval system