KEGG   Oceanisphaera profunda: CBP31_09250Help
Entry
CBP31_09250       CDS       T04856                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
opf  Oceanisphaera profunda
Pathway
opf00020  Citrate cycle (TCA cycle)
opf00480  Glutathione metabolism
opf01100  Metabolic pathways
opf01110  Biosynthesis of secondary metabolites
opf01120  Microbial metabolism in diverse environments
opf01130  Biosynthesis of antibiotics
opf01200  Carbon metabolism
opf01210  2-Oxocarboxylic acid metabolism
opf01230  Biosynthesis of amino acids
Module
opf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
opf_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:opf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBP31_09250
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CBP31_09250
Enzymes [BR:opf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CBP31_09250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF1018
Motif
Other DBs
NCBI-ProteinID: ART82789
UniProt: A0A1Y0D5I9
LinkDB All DBs
Position
complement(2121437..2123668)
Genome map
AA seq 743 aa AA seqDB search
MTNKKSTIVYTLTDEAPALATYSLLPIVRTFANSAGIDVTLSDISLASRILAAFPESLSE
EQRVTDGLSELGELTLDPSANIIKLPNISASVPQLRACIRELQSQGFAIPNLPEEAKTAA
EKSALERYSRIIGSAVNPVLRQGNSDRRAPAAVKAFVRKYPHSMGKWSKASRSHADYMHG
GDFFSSEQSVTLDKAQTVRIEFIDKDGKVTVKKSLPMQQGEVLDGMFMSAKALSRFFERT
LKDCKDTGVMWSLHVKATMMKVSHPIVFGHAVKVFYRDVFEKYGDLFDELGVNANNGMNS
VLDKIKSLPQSTQEEIERAIHDCYEHRPKMAMVDSVKGITNLHVPSDVIVDASMPAMIRS
SGKMWARDGKLKDTKAVMPESTYARIYQEVINFCKTNGAFDPVTMGTVPNVGLMAMKAEE
YGSHDKTFELTEDGTMRIVDENGTVLMQHDVEKGDIWRACQTKDAAVHDWVKLAVTRARQ
SNTPAVFWLDAERAHDNELRKKVETYLQEHDLNGLDIQIMSYNEAIRFSMERIIRGQDTI
SVTGNVLRDYLTDLFPILELGTSAKMLSIVPMLAGGGMYETGAGGSAPKHVQQLLEENHL
RWDSLGEFLALAVSLEELGIKEGNAKAKLLAKYLDKATELLLDNGKSPSRKAGELDNRGS
HFYLSLYWAQQLAAQTEDSELAAHFAPLAKSLAENEQKIIDELNQVQGSAAALSGYYHMD
AAALNKVMRPSDTFNQTLASLEK
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgaccaataaaaaatcgaccatagtttatacattgaccgacgaagcacccgccctggcc
acttattctttactgccgatagtgcgcacctttgccaacagcgccggcattgacgtgacc
ttaagcgatatctctctggctagccgtattttagcggccttccccgagagcctgagcgaa
gaacaacgcgtcaccgacggcttaagcgagctaggtgaactcaccctagacccttctgcc
aacatcatcaaactgccaaacatcagtgcctctgtgccgcagctgcgcgcctgtattcgc
gagctacaaagccaaggctttgctatccctaatctgccagaagaagccaaaaccgccgcc
gaaaaatccgccctggagcgctactcgcgcattatcggcagtgccgtaaacccagtattg
cgccaaggtaactcagatcgtcgcgcgccggccgccgttaaagcgttcgtgcgtaaatat
ccgcattccatgggtaagtggagcaaggcatctcgctctcacgccgattacatgcacggc
ggcgacttcttctctagcgaacagtcagtgacgctggataaagcacaaactgtgcgcatc
gaatttatcgataaagacggcaaggtgaccgttaaaaaatccttaccgatgcaacaaggt
gaagtgctagatggcatgtttatgagtgccaaagcattgtcgcgtttttttgagcgcaca
ctaaaagactgtaaagacaccggcgtgatgtggtcgctgcacgtaaaagccaccatgatg
aaggtgtcgcatcccatcgtatttggccatgcggtaaaagtgttttatcgtgacgtgttt
gaaaaatacggcgatctctttgacgagctgggcgtgaatgccaataacggcatgaacagc
gtattagataaaataaagtcgctgcctcagtccacccaagaagaaattgagcgcgcgatt
cacgactgctacgagcatcgcccaaaaatggccatggtcgactcagtaaaaggcattact
aacctgcatgtaccgagcgatgtgatcgttgatgcatctatgccggctatgatccgcagc
tcaggcaaaatgtgggcccgtgatggcaagctaaaagacaccaaagcagtaatgccagaa
agtacctatgcccgcatctatcaagaagtgatcaacttctgtaagaccaacggcgccttt
gatccggtcactatgggtaccgtacccaacgtcggcttaatggcgatgaaggccgaagaa
tacggctctcacgacaagacctttgaattgactgaagacggcaccatgcgcatcgtcgac
gaaaacggcactgtgttgatgcagcatgatgtggaaaaaggtgatatttggcgcgcttgc
caaaccaaagacgccgccgtgcatgactgggtgaaactggccgtgacccgtgctcgtcag
tctaatacgcctgcagtattctggttggatgcagaacgcgcccatgacaatgaactgcgt
aaaaaagtagagacctatctgcaagagcatgacttgaatggtttagatattcagatcatg
tcttataacgaagccattcgtttctccatggagcgcatcatccgcggccaagacaccatt
tcggtaaccggtaacgtgctacgtgactacctcaccgacttgttccctatcttagagttg
ggtacatctgccaaaatgttgtctatcgtgccaatgctggccggtggcggcatgtacgaa
accggtgccggcggttcagcgcctaaacacgtgcaacagctgttagaagaaaaccacttg
cgttgggactctctaggcgagtttttagcgctggcagtatctctcgaagagctgggcatt
aaagaaggcaatgctaaagccaagttactggctaagtatttggataaagccaccgaatta
ctgctggataacggcaagtcgccgtcacgcaaagccggcgagttggataaccgcggcagt
cacttctatttaagcctgtactgggctcagcagttggcagcacaaaccgaagacagcgag
ctggccgcgcactttgcgccactagcgaaatctttggcggagaatgaacaaaaaattatc
gacgaactgaaccaagtacaaggttccgccgccgcactgagtggttattaccatatggac
gccgccgcgttaaataaggtaatgcgcccaagtgacacctttaaccaaacactggctagc
ttagaaaaataa

DBGET integrated database retrieval system