KEGG   Oceanisphaera profunda: CBP31_11680Help
Entry
CBP31_11680       CDS       T04856                                 

Definition
(GenBank) hypothetical protein
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
opf  Oceanisphaera profunda
Brite
KEGG Orthology (KO) [BR:opf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:opf02000]
    CBP31_11680
Transporters [BR:opf02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   CBP31_11680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 HlyD Biotin_lipoyl YdfA_immunity TMEM154
Motif
Other DBs
NCBI-ProteinID: ART83190
UniProt: A0A1Y0D6N7
LinkDB All DBs
Position
complement(2648744..2649916)
Genome map
AA seq 390 aa AA seqDB search
MNKANHPAADTDSSAHQADATLQTDASSQQAASAPAMSPAQGRIRLVLLVLVPLLAAIIG
LTFYLLGGRYVETDNAYVKADKVPISTQVSGLVAKVAVQENQRVDANQLLFSLDSADFRV
AQAEAEAKLAQVVTDLNALKASFAEKQAELDVASSQLSYAKKQENRQANLSIKNYTSAAM
LDDARQNTQLAALKIAALKQDIARIRANLAGGPELPIKQHPLYRSAQAELERAQLNLERV
EVRAAVAGVVSNVPKAGQYLHAGNLAMMLIATDSPWVEANFSETDITHMRPGQPVTISVD
AYPDYKWQGTVDSLSPGTGAEFSVIPAQNATGNWVKITQRVPVRIHLIAPTQDETATGNN
EQAAPPLRAGLSAKVKVDTEQQSRLNNWSR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagctaaccatcccgccgctgatacggactctagcgctcatcaggctgacgcc
actcttcaaactgacgccagcagccagcaagcagcctctgcgccagccatgtcgccggcg
cagggccgcattcgcttggtgttactggtattagtgccactgctcgccgccatcataggc
ctcactttttatttgctcggcggccgttatgtggaaaccgacaacgcttatgttaaagcc
gacaaggtgccgatcagcacccaagtatccggcttggtggcaaaggtggcggtacaagaa
aaccagcgggtggatgcaaaccaactgctatttagcttagacagcgccgatttcagggtc
gcgcaggcagaagccgaggcaaaattggcacaagtggtcacggatcttaacgcccttaaa
gccagttttgcggagaaacaagcggaattggatgtggcgagttcgcagctgagctacgca
aaaaaacaagaaaatcgccaagctaacctaagtattaaaaattacacttcagcggccatg
ctcgacgatgcccggcaaaacacccaattagcggcgctaaaaattgccgcccttaagcaa
gacatagcacgtattcgtgccaacttagccggcggccctgagctgcccattaaacagcat
cctttatatagaagcgcccaagccgagctggaacgtgcccagttaaatctggagagagtg
gaagtacgcgccgccgtcgcgggtgtggtcagcaatgtccccaaggcgggccagtatcta
cacgcgggcaatttggccatgatgctgatagccaccgactccccttgggtggaagcgaat
tttagtgaaaccgacatcacccatatgcgccccggccagccggtgaccattagcgtggat
gcctatccagattataaatggcagggtaccgtcgacagcttaagcccaggtaccggtgcc
gagttttcggtgataccggcgcaaaatgccaccggcaactgggttaaaatcactcagcgg
gtgccggtgcgtattcacttaatagcgcccactcaagatgaaaccgcgaccggtaataac
gagcaagccgcgccgcctttacgggcgggcttaagtgctaaagtcaaagtggatactgag
caacaaagccgtttaaataattggtcgcgttaa

DBGET integrated database retrieval system