KEGG   Obesumbacterium proteus: DSM2777_00940
Entry
DSM2777_00940     CDS       T04310                                 

Definition
(GenBank) lytic transglycosylase
Organism
opo  Obesumbacterium proteus
SSDB
Motif
Pfam: SLT SLT_3
Other DBs
NCBI-ProteinID: AMO79751
LinkDB
Position
complement(171355..171990)
AA seq 211 aa
MATRRILMSALLMLPLCGVAKSVQPLQQIPPAYHQIAAAARVPAESLYSLALTESSRRLP
YGERPWPWTINVAGKGYRFESREAAWQALLQFVRKYPLKRIDVGIAQVNLGWNGHLFTSF
YEAFDPYTNLRVAANILRTCYDASPGSWIKAAGCYHHPAGGKAAATYIAIVRRKLDTLAP
VQQASDTHYLMPTPLKGVALASNQLTWIEPK
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcaactcgccgcattctgatgtcagcactgttaatgctgccgctgtgcggcgttgcg
aaaagcgttcagccgcttcagcaaattccgcctgcctaccatcagatcgcggcggcggcg
cgggtgccagcggagtcgttatattccctggccctgactgaaagctcccggcgtcttccg
tatggcgaacgtccgtggccctggacaattaatgtggcgggcaagggctatcggtttgaa
tcccgcgaagccgcctggcaggccctgctgcaatttgttcggaaatacccgctcaaacgc
atcgatgtcggtattgctcaggtcaatctggggtggaatggccatctgtttacctccttt
tatgaagccttcgacccgtacaccaacctgcgcgtcgcggctaacattcttcgaacctgc
tatgacgccagtccggggagctggattaaagcggcagggtgttaccaccacccggccggc
ggtaaagccgcggccacctatatagcgatcgtgcgccgtaagctcgacaccctggccccc
gttcagcaagcttctgacacacattatctgatgccgacgccgctgaagggagttgcgctg
gccagtaatcaactcacctggatagagcccaaatga

DBGET integrated database retrieval system