KEGG   Obesumbacterium proteus: DSM2777_04305Help
Entry
DSM2777_04305     CDS       T04310                                 

Definition
(GenBank) inner membrane protein YhjD
  KO
K07058  membrane protein
Organism
opo  Obesumbacterium proteus
Brite
KEGG Orthology (KO) [BR:opo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    DSM2777_04305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AMO80327
UniProt: A0A4V2J2E3
LinkDB All DBs
Position
complement(893501..894484)
Genome map
AA seq 327 aa AA seqDB search
MLMPKEFDQKSSKATVTTQVAKTLDKANGVMSWFKAIPSVAHVIRAVDRFNDRLGSQFGA
AITYFSFLSLIPILMVSFAAVGFVLASNPDLLTELINKIVSSISDPNLATTLKNTVNTAI
QQRTTVGLTGLAIALYSGISWMGNLREAIRAQSREVWERNPQDQEKFYFRYLRDFISLTG
LVIALIVSLSFTSIAGAAQASIVRALGLDGIEWLRPVMTAIALSISIMANYLLFLWIFLV
LPRHKPKKKALLRGTLIAAIGFEVIKFVMTWTLPSLARSPSGAAFGSVIGLMAFFYFFAR
LTLFCAAWIATADYDGDTTVERKKPQP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcttatgccgaaagaattcgaccaaaaaagcagtaaagcaaccgtcaccacgcaggtg
gcgaaaacgctggataaagccaatggcgtaatgtcctggttcaaagccattcccagcgtg
gcccatgttatccgcgcagttgatcgctttaatgaccgcctaggcagtcagttcggtgca
gcgattacctacttttcgtttttgtctcttatccctattttgatggtgtcgtttgccgct
gtcggttttgtgcttgcctcaaatcccgatttgctgactgaattgattaataaaatagtc
agtagcattagcgatcccaatttggcgacgacactaaaaaataccgtgaataccgccatc
cagcagcgtaccaccgtgggtctgaccggtttagccattgcgctctattcaggcattagt
tggatgggaaatctgcgtgaggcgattcgcgcgcagtctcgagaggtttgggagcgtaat
ccgcaggatcaggaaaaattctacttccgctacctgcgcgattttatttcgctaacaggt
ctagtgattgcgctgattgtttcgctttcttttacgtctatcgcaggtgccgcgcaagct
tctattgttcgcgccttaggcttagacggcatcgaatggctacgccccgtgatgacagca
attgcgctatccatttcgatcatggctaactatctgttgttcctttggattttcttagta
ttgccgcgtcataaaccaaagaaaaaagccttgctgcgtggaaccttaattgcagcgatt
ggctttgaagtgattaaatttgtgatgacgtggacgctgcctagccttgcacgctcacct
tccggcgcggcgtttgggtcggtcattggtctgatggctttcttctatttcttcgcccgc
ttaacgctattttgcgccgcgtggattgccaccgccgactatgacggcgacaccaccgta
gaacgcaaaaaaccgcagccctaa

DBGET integrated database retrieval system