KEGG   Obesumbacterium proteus: DSM2777_04460Help
Entry
DSM2777_04460     CDS       T04310                                 

Definition
(GenBank) formate dehydrogenase
  KO
K00127  formate dehydrogenase subunit gamma
Organism
opo  Obesumbacterium proteus
Pathway
opo00630  Glyoxylate and dicarboxylate metabolism
opo00680  Methane metabolism
opo01100  Metabolic pathways
opo01120  Microbial metabolism in diverse environments
opo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:opo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DSM2777_04460
  09102 Energy metabolism
   00680 Methane metabolism
    DSM2777_04460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ni_hydr_CYTB DUF4405 PepSY_TM
Motif
Other DBs
NCBI-ProteinID: AMO80356
LinkDB All DBs
Position
complement(932763..933395)
Genome map
AA seq 210 aa AA seqDB search
MKKEKPIQRYSAPERINHWVVAFCFIVVSISGLGFFFPSFNWLMNVFGTPQLARILHPFF
GVVMFASFLIMFFRYWKHNLINREDITWAKSIHKIAMNEEVGDTGRYNFGQKCVFWAAIG
SLLLLLASGIVIWRPYFADAFSIPVIRLALMVHSFAAVLLIIVIMVHIYAALWVKGTITA
MVEGWVPAAWAKKHHPRWYREVKAKEQERK
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggaaaagccgattcagcgttactcagcgccagaacggattaaccactgggtg
gtggcgttctgctttattgtggtgtccatcagcggcttggggttctttttcccctcgttt
aactggctgatgaatgtctttggtacgccgcagctcgcacgcatcctgcatcccttcttt
ggggtggtgatgttcgcttcgttcctgatcatgttcttccgctattggaaacataacctg
atcaatcgcgaagacatcacatgggcaaaaagcattcataagatcgcgatgaatgaagaa
gtgggtgataccggtcgctataactttgggcagaagtgtgtgttctgggccgccatcggc
agcctgctcctccttttggccagcggcatcgtgatttggcgcccttatttcgccgatgcg
ttctccattccagtgatccgtttggcgctgatggtgcattcattcgccgcagtgctgctg
attattgttattatggtacatatctatgcggcgctgtgggtgaaaggtacgatcaccgcg
atggtcgaaggctgggtacctgctgcatgggccaaaaaacatcatccgcgctggtatcga
gaagtgaaagccaaagaacaagagcggaagtaa

DBGET integrated database retrieval system