KEGG   Obesumbacterium proteus: DSM2777_04565Help
Entry
DSM2777_04565     CDS       T04310                                 

Definition
(GenBank) RNA polymerase factor sigma-32
  KO
K03089  RNA polymerase sigma-32 factor
Organism
opo  Obesumbacterium proteus
Brite
KEGG Orthology (KO) [BR:opo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:opo03021]
    DSM2777_04565
Transcription machinery [BR:opo03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     DSM2777_04565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4 Sigma70_r2 Sigma70_r1_2 HTH_10 KORA HTH_AsnC-type GerE UCR_14kD HTH_23 DUF5412
Motif
Other DBs
NCBI-ProteinID: AMO80373
UniProt: A0A4Q9D0X5
LinkDB All DBs
Position
954835..955686
Genome map
AA seq 283 aa AA seqDB search
MTKEMQTLTLVPQGSLEAYVRAANTYPMLTAEEEKELGERLHYEGDLDAAKQLILSHLRF
VVHVARNYAGYGLPQADLIQEGNIGLMKAVRRFNPEMGVRLVSFAVHWIKAEIHEYVLRN
WRIVKVATTKAQRKLFFNLRKTKQRLGWFNQDEVELVARELGVSEKDVLEMESRMAAQDM
AFDMSNDDDDSSPAAPVLFLQDKSSDFANDIEDDNWDSHAADKLSLAMEGLDERSQHIIR
ARWLDDDNKATLQELADQYGVSAERVRQLEKNAMKKLRAAIEA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagagatgcaaactttaaccttagttcctcaaggtagcttggaagcttacgtt
cgtgcggccaacacctatccgatgctgacagcagaggaagagaaagaactgggtgaacga
ctgcattacgagggtgacttggatgcagcaaaacagctgattctgtcgcacctgcgcttt
gttgttcatgttgcccgtaactatgccggctacgggttgccgcaggcagacctaattcag
gaaggtaacatcggcctgatgaaagctgtgcgtcgttttaacccagaaatgggcgtacga
ctggtgtcctttgcggttcactggatcaaagctgaaattcacgaatacgtgctgcgtaac
tggcgcatcgtgaaggttgcgaccaccaaagcccaacgtaagctgttcttcaacctgcgt
aaaaccaagcagcgtttaggctggttcaatcaggatgaagttgaattggttgctcgcgag
ctgggcgtgtctgaaaaagacgtgctggaaatggaatcgcgtatggccgcgcaggacatg
gcttttgacatgtctaacgacgacgatgacagctcacctgctgcgccagtgctgttccta
caggataaatcttctgatttcgccaacgatatcgaagatgacaactgggatagccacgcc
gctgacaaactgagcttggcgatggaaggcttggatgagcgtagccagcacattattcgt
gcccgctggttagacgacgacaacaaagcaacgctgcaagaactggccgatcaatacggt
gtgtctgcagaacgtgtgcgtcagcttgaaaagaacgcaatgaaaaaactgcgtgcagca
attgaagcttaa

DBGET integrated database retrieval system