KEGG   Obesumbacterium proteus: DSM2777_04765Help
Entry
DSM2777_04765     CDS       T04310                                 

Definition
(GenBank) pimeloyl-[acyl-carrier protein] methyl ester esterase
  KO
K02170  pimeloyl-[acyl-carrier protein] methyl ester esterase [EC:3.1.1.85]
Organism
opo  Obesumbacterium proteus
Pathway
opo00780  Biotin metabolism
opo01100  Metabolic pathways
Module
opo_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:opo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DSM2777_04765
Enzymes [BR:opo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.85  pimelyl-[acyl-carrier protein] methyl ester esterase
     DSM2777_04765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Abhydrolase_5 FSH1 Esterase Ndr UPF0227 PGAP1
Motif
Other DBs
NCBI-ProteinID: AMO80409
LinkDB All DBs
Position
1000241..1001020
Genome map
AA seq 259 aa AA seqDB search
MNKLYWHTSGEGDRDLVLLHGWGLNAEVWRCILPRLSTQFRVHLIDLPGYGRSQGFGALT
LEQMSDIVMQQAPDNAVWLGWSMGGLVASDIALRYPERVAALVTVSSSPCFTAQGEWPGI
KSEVLSGFQRQLSEDFKRTVERFLALQTLGTESARQDARILKDVVLTQPMSSVEVLNGGL
DILRSVDLREQMADLNMPLLRIYGYLDGLVPRKVAALLDESCPNSESVVIQKSAHAPFVS
HPGEFCGVVESWVQEVGKV
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaataagctttattggcataccagcggcgaaggcgatcgcgatcttgtgttgttgcac
ggatggggattgaacgcagaggtatggcgttgcattttgccgcgattgagcacgcagttt
cgtgtgcacctcatcgacttgccgggctatggacgcagccaaggatttggcgctttaacg
ctggagcaaatgagcgatatcgtgatgcagcaggcgcctgacaatgcggtttggctcggt
tggtcgatggggggcttggtcgccagtgatattgcactgcgttacccagaacgtgttgcc
gcgctggtgaccgtatcgtcttcgccatgtttcaccgcccaaggcgagtggccgggtata
aaaagcgaagtgttaagcggatttcagcgccaactgagtgaagatttcaaacgcaccgta
gagcgctttttagctctgcaaaccttaggtactgaaagcgctcgacaggatgcgcgaatt
ttaaaagacgtcgtcctgactcagccgatgtcttctgtggaggtattaaacggtggacta
gatatcctgcgctccgtggatttacgtgagcaaatggctgatttgaacatgccgttgctg
cgtatttacggttatttggatggattggtgccgcgcaaggttgctgcgctgctcgatgaa
tcttgcccgaatagcgaatctgtcgttattcagaaatcggcgcatgcgccgtttgtgtca
catccgggggagttttgtggggtagtggagagttgggttcaagaagttgggaaggtataa

DBGET integrated database retrieval system