KEGG   Obesumbacterium proteus: DSM2777_04825Help
Entry
DSM2777_04825     CDS       T04310                                 

Definition
(GenBank) Intracellular growth attenuator protein igaA
Organism
opo  Obesumbacterium proteus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IgaA
Motif
Other DBs
NCBI-ProteinID: AMO80420
UniProt: A0A4Q9D555
LinkDB All DBs
Position
complement(1014816..1016930)
Genome map
AA seq 704 aa AA seqDB search
MSAPAIASILLILCLLIAGCAYWSKMKKSALLTTSFPFLKTKLRKLQKDELQAIEQYLNK
LDSPSGSSHAPMPVAQHRLMPQGDRVYPLVHAITRYELTTDDPNKRRYYLDNIEVHLPVF
WEQYIADDNQLEVIKTHSIPLVISINGHSLVDAAHEDLLPPPDSTSSASIRQTESEKVEL
QGVRKETQLEYQLSQQGGIRESIVIVVALLMLYASLMSPNALMPWLLTVATGLIAWGIWR
LYSRPSERDLKEIHCIRGIPKRWGLFGESNVGQINNVSLGTLDLIYPAHWQNYIQKDLGH
KTDIEMYLSRHVVRQGRFLSLHDEVKNFPLQRWGRNIVLLGGALLTLTLLLTTQPLSIPF
KLSSAWLHGTHSVDVNSVKSLAALPLHVGDTLNIQGTGMCRVPASYQDGVRYPFMPFDCS
AIYWSNATPMSAPASDIVDNAAALLATVNRQLNANNEDQKVNPGLASAIQKSGMILLDDF
ADIVLRTEDLCAQQSECTRLKNSLVNLGNSKSWSALLKKAQNGGLDGVNVLLRPASAQLL
SNIVNSAVSSFYYRETHQAAQSLTATPPGGFLIISDEGKQLVNHPQPAISLYDYTAIDQW
RELESLSQQLLATPFKASGVITELSTDANGTRHIMLHSEPDGLTLWRYILTCALLLAVTL
IIIVNALMFMFRIQKSMNRIPEIQRYYDQCINHNIMPFDTAPRR
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaccagctatcgcatcaatcctactgatcctttgcctgctgattgccggatgt
gcctattggtctaagatgaaaaaatctgccttattaacaacatctttcccatttcttaaa
actaaactgcgcaaactgcaaaaagatgaacttcaggccattgagcaatatctcaataag
ctagactctccttcaggttcttctcatgcacccatgcccgtagctcaacatcgcctgatg
cctcagggggatcgcgtttacccgctcgtccatgcgataacccgctacgaactgaccacc
gacgatcccaataaaagacgctattaccttgataatattgaggttcacctgcccgttttt
tgggaacaatatatcgccgacgataaccagcttgaggtgatcaaaactcacagcattcct
ttggttatctccatcaacggccactcgttggttgacgcagcacacgaggatttgcttcct
cctcccgatagcaccagcagcgcttcaattcgccaaaccgaaagtgaaaaagtcgagctg
caaggcgttcgcaaagaaacccagttggagtaccagctcagccagcaaggcggtattcgc
gaatctatcgtcatcgtggtggcattactcatgctgtatgccagcctcatgagccctaac
gccttgatgccgtggctgctcaccgttgccacggggcttatcgcatggggtatttggcgc
ttgtacagtcgcccttccgaacgcgatctgaaagaaatccactgcatccgcgggatcccc
aaacgctgggggttatttggcgagtctaacgttgggcaaatcaacaacgtatctctaggc
accttagatctcatctatcccgcacattggcagaactatattcaaaaagatctcgggcat
aaaaccgatatcgagatgtatctcagtcggcacgtggtgcgtcaggggcgtttcctctca
ctgcacgatgaggttaaaaactttcccctgcagcgctggggacgcaatatcgtgctgctc
ggtggagcgcttcttacgctcacgttgctgctcacgactcagcctctcagcatcccattc
aaactcagctccgcgtggttacatggaacacacagcgttgatgtgaatagcgtgaaatcg
ctggctgcgctgccgctgcacgttggggataccttaaacattcaaggtaccggcatgtgc
cgtgttcccgcgtcctatcaagacggagtgcgctatccctttatgccttttgattgctcg
gcgatttactggagcaacgcaaccccaatgtctgcacccgcgtctgatatcgtagataac
gccgcggcattgcttgcgacggtgaatcgccagctaaacgcgaacaatgaagatcagaaa
gttaacccaggactggctagcgcaattcaaaaatccggcatgatcttgctagatgacttt
gctgatatcgttttgcgaaccgaagatctctgtgcgcaacagtctgaatgcacaagacta
aaaaattcgctggtgaatcttggcaacagcaaatcatggagcgcactgctgaaaaaagcg
caaaacggggggctggacggcgtgaacgtgctgctacgtccggcgagtgcccagctatta
tcaaacatcgtcaatagcgccgtctcttcgttctattatcgcgagacgcatcaggccgca
cagtcactcaccgcaacgccgccgggcgggtttttgattatcagcgatgaaggtaagcag
ttggtaaatcatccacagcctgccatttcactctacgattacacggctatcgatcagtgg
cgtgagctggagtcactctcacagcagctactggctaccccgtttaaagccagcggcgtg
atcaccgagctaagtaccgatgccaacggtactcggcatattatgttgcacagcgaaccc
gacggcctaacgctatggcgatacatcttaacctgcgcactgctgctcgctgtgacgctg
attattatcgttaacgcactgatgtttatgttcagaatacagaaatcgatgaatcgtatt
cctgagatacaacgttactacgaccagtgcattaaccataacatcatgccttttgatacc
gccccgcgccgttaa

DBGET integrated database retrieval system