KEGG   Obesumbacterium proteus: DSM2777_05910Help
Entry
DSM2777_05910     CDS       T04310                                 

Definition
(GenBank) D-alanyl-D-alanine-carboxypeptidase/endopeptidase AmpH
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
opo  Obesumbacterium proteus
Brite
KEGG Orthology (KO) [BR:opo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:opo01002]
    DSM2777_05910
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:opo01011]
    DSM2777_05910
Enzymes [BR:opo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DSM2777_05910
   3.4.21  Serine endopeptidases
    3.4.21.-  
     DSM2777_05910
Peptidases and inhibitors [BR:opo01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   DSM2777_05910
Peptidoglycan biosynthesis and degradation proteins [BR:opo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   DSM2777_05910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AMO80620
LinkDB All DBs
Position
complement(1248386..1249537)
Genome map
AA seq 383 aa AA seqDB search
MDKRVLKFFPATLLGVACAVIPVTIYAQQPQPLASQVVDGYAEHIFYNSGAAAMAMVAID
NNQQVFRSFGETRPGNDTRPRKDSLIRIASLTKLMTSEVLVKLADERKVSLYDPLRKYAP
NGMRVPSYNANQPIVLMNLASHTSGLPREQPGGVAHRDVFTWPTKYDRWQWMKSAKVAVP
PGVRASYSNLAFDLLADALAQATGKAYPSLLKEKVTLPLGMKDTTYTPSPEQCSRMIVPA
RGASPCQSSLAAIGSGGVYSTPEDMQRWMQQFLSSSTHPRSPYADKLLKMYYQREKLTLV
KGMDVPGKASALGLGWVYMAPQNGLPGIMQKTGGGGGFITYMAMIPDKNVGVFAVVARTE
LTKFTNMSDGVNRLVSELAQQQQ
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggataaacgcgtgttgaaatttttccctgcgacgctgctgggcgtcgcctgtgcggta
atacctgttacaatttatgctcaacaacctcaacctctcgcttcacaggtggtggatggt
tacgcggagcatattttttataatagcggtgccgctgcaatggccatggttgctatcgat
aacaaccaacaggtgtttagaagttttggcgaaactcgccccggcaatgatacccgccca
cgtaaggactctttaatccgtatagcttccctaaccaaactcatgaccagcgaagtcttg
gttaagctagccgatgaaagaaaagtcagtctctacgatccattgagaaagtacgcgcct
aacggaatgcgagtaccctcctataacgccaaccagccgattgtgttgatgaacctcgcc
tctcacaccagcggtttaccgcgtgaacagccgggcggcgtggcacatcgtgacgtgttt
acttggccaacgaaatacgatcgctggcagtggatgaaaagcgcaaaagtcgcggtgcca
ccaggcgtgcgggcgtcctattcaaatctggcgtttgacttactggccgatgcgcttgca
caagctacgggcaaagcctatccaagtttgctcaaagagaaagttactctgccgttgggc
atgaaagacaccacctatacgccctcccctgaacaatgctcacggatgatcgtccccgca
cgcggagcaagcccatgccaaagcagcctcgcggctatcggcagcggtggcgtttattcc
acaccggaagacatgcagcgttggatgcagcagttcttatcctcctcaacccatcctcgt
agcccgtatgctgacaagctgctgaaaatgtattatcagcgcgaaaaacttacgctggtt
aaaggcatggacgttccgggtaaagcctcggcactgggcttaggctgggtatatatggca
ccgcaaaacggtttaccgggcatcatgcaaaaaactggcggcggcggcggcttcattacc
tatatggcgatgatcccagacaaaaacgttggcgtatttgcggttgttgcccgtactgaa
ctaaccaaatttactaatatgagcgatggtgttaatcggttagtcagcgagctggcgcag
caacagcagtaa

DBGET integrated database retrieval system