KEGG   Obesumbacterium proteus: DSM2777_06325Help
Entry
DSM2777_06325     CDS       T04310                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
opo  Obesumbacterium proteus
Pathway
opo00250  Alanine, aspartate and glutamate metabolism
opo00410  beta-Alanine metabolism
opo00430  Taurine and hypotaurine metabolism
opo00650  Butanoate metabolism
opo01100  Metabolic pathways
opo01110  Biosynthesis of secondary metabolites
opo01120  Microbial metabolism in diverse environments
opo02024  Quorum sensing
Module
opo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:opo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DSM2777_06325
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DSM2777_06325
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DSM2777_06325
   00430 Taurine and hypotaurine metabolism
    DSM2777_06325
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DSM2777_06325
Enzymes [BR:opo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     DSM2777_06325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AMO83822
LinkDB All DBs
Position
complement(1358651..1359931)
Genome map
AA seq 426 aa AA seqDB search
MFNAVRDELMLDGNSRQNLATFCQTWVDEEIRDLMDLSIDKNMIDKDEYPQTAEIETRCV
HMLADLWNSPSPETTLGCSTIGSSEAAMLGGLALKWQWRKKRAALGLSTDKPNLICGPVQ
ICWHKFARYFDVELREIPLQGDRLIMSPEEVLKRVDENTIGVVPTLGVTFTCQYEPVKQV
HDALDQLQKETGLDIPMHIDGASGGFLAPFCAPDLEWDFRLPRVKSINASGHKFGLAPLG
TGWVIWREAADLPQELIFNVNYLGGDMPTFALNFSRPGGQIIAQYYNFLRLGREGYAKIH
NARYSTAQYLAQEIEKLGPFEMIFDGDCEKGIPALAWKLKDNAATNGYTLYDLADRLRSR
GWQVPAYSMPAEREDLVVQRILVRHGVSRDLGSLLIDDMKRALDYFEKHPVSHALSEKEA
SGFNHG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
attttcaatgctgtgcgcgatgaattaatgttagacggaaactctcgtcaaaatttggca
actttttgccaaacatgggttgatgaagaaattcgcgatctgatggatttatcaattgat
aaaaacatgattgataaagatgaatatccgcaaactgccgaaattgaaactcgctgtgtt
catatgctggccgacctttggaactctccatcaccagaaacgacgctaggctgttcaacg
attggttcatcagaagccgccatgctgggtggattagcgcttaagtggcaatggcgtaaa
aagcgtgcagccttaggtctatcaaccgataagccaaacttgatctgtggcccggtacag
atttgctggcataaattcgctcgctattttgacgttgagctgcgtgaaattccgctgcaa
ggcgatcgtctcattatgagcccagaagaagtccttaagcgcgtcgacgaaaataccatt
ggcgtagtgccaacgctcggcgtcactttcacgtgccaatatgagcctgttaagcaggtc
catgacgccctcgatcagctacagaaagaaacaggtctggatatcccaatgcacattgat
ggcgcaagtggcggtttcttagccccattctgtgcaccggatcttgagtgggatttccgt
ttacctcgcgtaaaatctattaatgcttccggccacaaattcggccttgcaccactcggg
acaggctgggtgatttggcgtgaagcggctgacctacctcaagaactcattttcaacgtc
aattatctgggtggcgacatgccaaccttcgcgctgaatttctcgcgcccaggcggccaa
attattgcgcagtattacaacttcttgcgcttaggccgcgaaggctatgccaaaattcac
aatgcccgttattcaacggctcaatatttagcacaagaaattgaaaaacttggcccattc
gaaatgatctttgatggcgattgcgaaaaaggcatcccagcactggcttggaagctcaaa
gacaacgcagcaacaaatggctataccttgtatgacttggctgacagactgcgcagtcgt
ggttggcaggtaccagcctattccatgcctgctgagcgtgaagatctcgtggttcaacgc
attttagtgcgacatggcgttagccgcgatctcggtagcctactgattgatgatatgaag
cgggcactagattatttcgaaaaacatccagtcagccatgctctatcggaaaaagaagcc
agtggatttaatcacggttaa

DBGET integrated database retrieval system