KEGG   Obesumbacterium proteus: DSM2777_06855Help
Entry
DSM2777_06855     CDS       T04310                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
opo  Obesumbacterium proteus
Pathway
opo00250  Alanine, aspartate and glutamate metabolism
opo00280  Valine, leucine and isoleucine degradation
opo00410  beta-Alanine metabolism
opo00640  Propanoate metabolism
opo00650  Butanoate metabolism
opo01100  Metabolic pathways
opo01120  Microbial metabolism in diverse environments
Module
opo_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:opo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DSM2777_06855
   00650 Butanoate metabolism
    DSM2777_06855
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DSM2777_06855
   00280 Valine, leucine and isoleucine degradation
    DSM2777_06855
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DSM2777_06855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:opo01007]
    DSM2777_06855
Enzymes [BR:opo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DSM2777_06855
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     DSM2777_06855
Amino acid related enzymes [BR:opo01007]
 Aminotransferase (transaminase)
  Class III
   DSM2777_06855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AMO80790
LinkDB All DBs
Position
1476565..1477848
Genome map
AA seq 427 aa AA seqDB search
MSTNKELMQRRSNAIPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNKRVPGDFDKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVFRALYPCELHGVSD
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYSTSPAFMKRLRELCDEHGIMLIADE
VQSGAGRTGTLFAMEQLGVAADLTTFAKSIAGGFPLAGVTGKAEIMDAIAPGGLGGTYAG
SPIACAAALAVLETFDEENLLQRANDVGQKLKDGLLNIAEIHPEIGDVRGLGAMIAIELF
ENGDVHKPNAKLTAEVVARARDKGLILLSCGPYYNVLRILVPLTVSDAQIKQGLDIIAEC
FTEAKKN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaataaagaactgatgcagcgccgcagtaatgccattccacgcggcgtgggg
cagattcatcccatttttgccgagcgagcagaaaactgtcgcgtatgggacgtcgaaggg
cgcgaatatctggactttgccggtgggattgcggttctgaatacgggccatttgcatccc
aaagtggtcgctgcggttgaagctcagttgaaaaaactgtcgcacacctgcttccaagtg
ttggcctacgaaccgtatttagaactgtgcgaaatcatgaacaagcgcgttccgggcgat
tttgacaagaaaacgctgctggtgacgacgggctctgaagcggtagaaaacgcggtgaag
attgccagagctgccactaagcgcagcggaaccatcgcttttagcggtgcttatcacgga
cgtactcattacaccttgtcgttgaccggcaaagtaaacccttactcagcgggcatgggc
ttaatgcctgggcacgtattccgtgctttgtatccttgtgaattacacggcgtcagcgac
gatgatgccatcgccagtatccatcgcatcttcaaaaacgacgctgcgccggaagatatt
gccgccatcgttatcgaaccggtgcagggggaaggaggattctattcaacctcacctgcc
tttatgaaacgcctgcgcgaactgtgtgatgagcacgggatcatgctgattgctgatgaa
gtacaaagtggtgccgggcgcaccggaacgttgtttgcgatggaacagttaggcgttgct
gccgatctcaccacctttgcgaaatctatcgcgggcggtttccctctcgctggcgtgaca
ggcaaagccgagattatggatgccatcgcgccgggcggactgggtggaacctatgccggt
agccccattgcctgtgcggcagccctagcggtgcttgaaacctttgatgaagaaaatctg
ttgcagcgcgccaacgatgtggggcagaagctgaaagatggcctgctcaacatcgctgaa
attcatccagaaattggtgatgtgcgtggtcttggcgcaatgattgcgattgagctgttc
gaaaacggcgatgtgcataaaccgaatgccaaactgacggcagaagtggtggcgcgggcg
cgtgataaggggctcatcctgctgtcatgcgggccttactataacgtgctgcgtattttg
gttccgctcacggtgagtgacgcgcagatcaaacagggtctggatattatcgccgaatgt
tttaccgaggctaagaaaaactaa

DBGET integrated database retrieval system