KEGG   Obesumbacterium proteus: DSM2777_16165Help
Entry
DSM2777_16165     CDS       T04310                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
opo  Obesumbacterium proteus
Pathway
opo00480  Glutathione metabolism
opo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:opo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DSM2777_16165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:opo02000]
    DSM2777_16165
Enzymes [BR:opo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DSM2777_16165
Transporters [BR:opo02000]
 Other transporters
  Pores ion channels [TC:1]
   DSM2777_16165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_C_6 GST_N_5 Glyco_transf_8C Tom37
Motif
Other DBs
NCBI-ProteinID: AMO82432
UniProt: A0A4Q9DAP7
LinkDB All DBs
Position
complement(3388682..3389287)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKAGACSLSPHIVLREAGLDFTIERVDLATKKTEHGEDFLKINPKGQVPALQLDDG
SLLTEGVAIVQYLADKVPDRNLIAPAGSLARYHAIEWLNYIATELHKGFSPLFNPKTPEE
YKAIARQKLEQQFAYLNGVLSNQSYLLGARFSVADAYLFTVLGWAKALHFDLPAYPNIVS
YVARVAARPAVDAALTAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttttacaaagccggagcttgttctctctctccgcacattgttctgcgtgag
gctgggctagactttacgattgagcgcgtcgatcttgccactaaaaagaccgagcacggt
gaagacttcctgaagattaacccaaaaggccaagtacctgccctgcagttagatgacgga
agcctgttaaccgaaggcgttgccattgtgcaatatctggctgacaaggtgccagaccgt
aacctgatcgcaccggctggctcactggctcgctatcatgcaattgagtggctgaactat
attgcgaccgagttacacaaaggctttagcccgctgtttaacccgaaaactcctgaagaa
tataaagccatcgcacgtcagaaactggaacagcagttcgcctacctcaatggtgtactg
agcaatcaaagctatctgctgggcgcgcgctttagcgtcgccgatgcctatctgttcacc
gtgttaggctgggctaaagctttgcatttcgatctgccagcctatccaaacattgtcagc
tatgttgcacgcgtggctgctcgccctgccgttgacgctgcgctgacggctgaaggtttg
aagtaa

DBGET integrated database retrieval system