KEGG   Obesumbacterium proteus: DSM2777_16935Help
Entry
DSM2777_16935     CDS       T04310                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
opo  Obesumbacterium proteus
Pathway
opo00550  Peptidoglycan biosynthesis
opo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:opo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DSM2777_16935
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    DSM2777_16935
Enzymes [BR:opo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DSM2777_16935
Peptidoglycan biosynthesis and degradation proteins [BR:opo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   DSM2777_16935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AMO83940
LinkDB All DBs
Position
complement(3571080..3572993)
Genome map
AA seq 637 aa AA seqDB search
MSRLLEPFRDHSAEETLFIRRSIIAAVMVVLLFGVLVFNLYHLQVEEHDQYQTRSNANDI
KTLPIAPVRGLIYDRNGTPLVANQTLYQIELIPGKVANLDQTIKALTPIVDLTPDDINNF
HEAMKSSRRFAEVPLKEALTDVEVARFSVNEFEFPGVSISSYQQRYYPYGAELAHVVGYV
SKINDRDAKRLNEAGEGENYAADHDIGKQGIERYYERQLHGTTGSQEVEVDSHGRVVREL
TETPPQAGKNIYLTIDLPLQQYIEKLLKGQRAAVVVMDPRDGGILAMVSSPSYDPNPFVN
GISYKSYQALLDNPNLPLINRVTQGIYPPASTVKPFMATSALFAGVITPQTTFFGQPTWV
LPGTNRHYRDWLKTGHGMLNVTKAIEESADTFFYQVAYEMGIDRIHEWLSKFGYGQYSGI
DLMEQAKGVLPDRAWKQKVHKKVWYQGDTISVGIGQGYWTATPIQMVKALSTLINDGTTK
TPHLMYSMKQGNHVERYQQEEHTQVADPKSPIWGIVKKGMFGMANYPNGTGYKYFHTAPY
EIAAKSGTSQVFGLKQDQVYNAKMIPVKLRDHIFYTAFAPYSNPKVAIAVILENGGGDGV
SAAPTTRAILDYIFAKTKPVEPPVLPTLDASQLRDAH
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtttgctagagccatttcgcgatcacagtgctgaagagacgctgtttatccgc
cgttccattattgccgcggtgatggttgtgctgctatttggcgtattggtgtttaatctg
tatcacctgcaggtggaagagcacgatcagtaccaaactcgctcgaacgccaacgacatt
aaaactctgcccatcgcgccggttcgcgggttgatttatgaccgtaacggaacgccttta
gttgcaaaccaaacgctgtatcaaattgaactgatcccggggaaagtcgctaacttagac
caaacgatcaaagcgctgacgccgatagtggatttaacgccggatgacattaacaatttc
catgaggcgatgaagtcctcgcggcgttttgctgaagtacctcttaaagaagcgctgacc
gacgttgaagtcgcgcgtttttctgtcaatgaatttgagtttcccggcgtgtcgattagc
agttatcagcagcgttactatccttacggcgctgagctggcacacgttgttggctatgtt
tcaaagattaacgaccgcgacgccaaacgcttgaatgaggccggtgaaggtgaaaactat
gcggccgatcatgacatcggcaagcaggggatcgaacgttattacgagagacaactgcac
ggtaccacgggctcgcaggaagttgaggttgatagccatggccgcgtggtgcgcgagctc
accgaaaccccgccgcaggccggaaagaatatatatctgacgatagatcttcctctccag
caatatattgagaaacttctgaaagggcagcgcgccgccgtggtggtgatggatccgcgt
gatggcggtattttggcgatggtttctagcccaagctatgacccgaatccgtttgtgaac
ggcatatcgtataagtcctatcaggctttgcttgataatcctaacctgccattgattaac
cgtgtaacccaagggatttatccgcccgcatcaacggtgaaaccgtttatggctacatcg
gcgctgttcgccggtgttatcacgccgcagaccacgttttttggtcagcctacgtgggtg
cttcccggtaccaatcgccattatcgagactggctgaaaaccggtcatggcatgttaaac
gtgaccaaggcgattgaagaatcagcggatacgtttttctatcaggtggcctatgagatg
gggatcgatcgtattcatgaatggctgagcaaatttggctacgggcaatattccggcatc
gatttaatggaacaggcaaaaggcgttctgcccgatcgagcgtggaaacagaaagttcat
aagaaagtgtggtatcagggcgatacaatttctgtgggcattgggcaaggatattggact
gcaacgccgattcagatggttaaggcgttaagcacgcttatcaacgatggtacaacgaaa
acgccgcatttgatgtattcgatgaaacaaggcaaccacgttgagcgctatcagcaagaa
gagcacacgcaggtcgccgatccgaaatcgccgatctgggggattgtgaaaaaaggcatg
tttggtatggctaactatcctaatggcaccggctacaagtatttccacactgcgccttat
gaaattgcggcgaagtcaggcacgtctcaggtatttggactgaaacaagatcaggtttat
aacgccaagatgatccccgtgaagctgcgcgatcatattttctacacggcgtttgcgccg
tattcaaaccctaaggtcgcgattgccgttattttggaaaatggtgggggagatggtgtc
tcggcagcgccgacaacgcgtgccattctggattatatctttgctaaaaccaaacccgtt
gagccgccggtgttgcctacgcttgatgcttctcaactgcgtgacgcgcattaa

DBGET integrated database retrieval system