KEGG   Obesumbacterium proteus: DSM2777_21285Help
Entry
DSM2777_21285     CDS       T04310                                 

Gene name
pheA
Definition
(GenBank) bifunctional chorismate mutase/prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
opo  Obesumbacterium proteus
Pathway
opo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
opo01100  Metabolic pathways
opo01110  Biosynthesis of secondary metabolites
opo01130  Biosynthesis of antibiotics
opo01230  Biosynthesis of amino acids
Module
opo_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
opo_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:opo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DSM2777_21285 (pheA)
Enzymes [BR:opo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     DSM2777_21285 (pheA)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     DSM2777_21285 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT HCR
Motif
Other DBs
NCBI-ProteinID: AMO83354
LinkDB All DBs
Position
4549498..4550649
Genome map
AA seq 383 aa AA seqDB search
MTTDNPLLALREQISAVDSKLLALLSERRELAEAVARAKQKSHRPIRDKERERELLNSLT
EQGKALNLDGHYITRLFQLIIEDSVLTQQALLQHQYNHTTQKSARIAFLGPKGSYSHLAA
RQYAARHFEQLIECGCHRFQDIFNHVETGQADFAVLPIENTSSGSINDVYDLLQHTSLSI
VGELTIPIDHCVLVTGETRLSDIQTVYSHPQPFQQCSQFLNAYPQWKIEYCESTAAAMEK
VAALNSPHAAALGSEAGGSLYGLQPLEQNLANQQQNITRFIVLARKAIDVTSQVPAKTTL
IMATGQQSGALVEALLVFREHNIVITKLESRPINGNPWEEMFYLDVQANANDAAMKAALK
DLQAITRSLKTLGCYPSENIVPV
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgacaacagacaatccattactggcattacgtgagcagatcagcgccgtcgatagcaaa
ttactggcgctattgagcgaacgccgagagctcgcggaagccgtcgctcgagctaaacaa
aaaagtcatcgtccgattcgagataaagagcgcgagcgagaactattgaactctctgaca
gaacaaggaaaagcgcttaatcttgatggtcactacatcactcgtttatttcagctcatc
atcgaagactctgtcttaacccagcaggcactgctccaacatcaatacaatcacaccaca
caaaagtctgctcgtatcgcttttctcgggccaaagggttcttactcccacctcgccgct
cgccaatatgccgcgcgtcacttcgaacagctgattgagtgtggatgccatcgttttcag
gatatcttcaatcatgttgaaactggtcaagctgactttgccgtattgccgattgaaaat
accagctcaggctcaatcaacgacgtttacgacctgctgcaacacactagtctgtcaatc
gttggcgagcttaccattcctattgaccattgcgtgttagtcaccggcgagacacgtctc
agtgatattcaaacggtttacagccaccctcagccattccagcaatgcagccagttcctt
aatgcctatcctcagtggaaaattgaatactgtgaaagcaccgctgcggcgatggagaaa
gtcgctgcactcaactcaccgcatgccgcggcgcttggcagtgaggccggtggctcgctt
tatggcttacagccactggaacaaaatctggcaaaccagcaacaaaatatcacgcgtttt
atcgttctcgcacgtaaggccattgatgtcacctcgcaggtgcctgcaaaaactacgctg
attatggctacggggcagcaatcaggtgcgttggtagaagcgctgttagtctttcgtgag
cacaatattgttatcacgaaattggagtctcggcctatcaacggcaacccatgggaagag
atgttctatctggatgtacaggccaatgccaatgatgcggcaatgaaagcagcgctgaaa
gatttgcaagcaatcactcgttcactgaaaacactcgggtgctacccaagtgaaaatatc
gttcccgtttaa

DBGET integrated database retrieval system