KEGG   Oceanithermus profundus: Ocepr_0364Help
Entry
Ocepr_0364        CDS       T01369                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
opr  Oceanithermus profundus
Pathway
opr00040  Pentose and glucuronate interconversions
opr00051  Fructose and mannose metabolism
opr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:opr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ocepr_0364
   00051 Fructose and mannose metabolism
    Ocepr_0364
Enzymes [BR:opr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Ocepr_0364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C PrmA ADH_N_2 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ADR35824
UniProt: E4U603
LinkDB All DBs
Position
complement(357912..358943)
Genome map
AA seq 343 aa AA seqDB search
MRVAMYYNNHDVRLEEQPVPEIGPGEVLIKIVASGICGSDVMEWYRIKKAPLVLGHEIAG
DIVAVGEGVTGFQPGDRVTATHHVPCGRCEYCQRGQHSLCPLISNTTYDPGGFAEYVRVP
AINVETRGVLKLPDSVSYEEGSFTEPLGCVVRGLRVMGFEPARSVLVLGSGLSGQLVIRT
ARAYGAGKIIATDINDFRLEMARRSGAEVALHATREDVVQRVLEETNGEGVDYVIPTAAA
PALFDQAMQTVRKGGTVLLYGIMAPGTKVAFDVFPFWKKQVKLLSTYAAAPRDLAEALEL
IRARRVPVEDLITHRLPLAETQKGFELTAAGGDSMKVIIEPQR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtagccatgtactacaacaaccacgacgtgcgcctggaggagcagccggtcccc
gagatcgggcccggcgaggtgctcatcaagatcgtcgccagcggcatctgcggctccgac
gtgatggagtggtaccgcatcaagaaggcgccgctggtgctggggcacgagatcgccggc
gacatcgtggccgtcggcgagggcgtgaccgggttccagcccggcgaccgcgtgaccgcc
acccaccacgtgccctgcggccgctgcgaatactgccagcgcggccagcactcgctttgc
cccctgatcagcaacaccacgtacgacccggggggcttcgccgagtacgtgagggtgccc
gcgatcaacgtcgagacccggggggtgctcaagctgcccgactcggtgagctacgaggag
ggcagcttcaccgagcccttgggttgcgtggtgcggggcctgcgggtgatggggttcgag
cccgcgcgcagcgtgctggtgctggggagcgggctctcaggccagctcgtcatccgcacc
gcccgcgcctacggcgccgggaagatcatcgccaccgacatcaacgacttccggctcgag
atggcgcgcaggtcgggggccgaggtggccctccacgccacccgcgaggacgtggtgcag
cgggtgctcgaggaaacgaacggcgagggcgtggactacgtcatccccaccgccgccgcg
ccggcgctcttcgaccaagccatgcagacggtcaggaagggcggcaccgtgctgctctac
ggcatcatggccccgggcaccaaggtggcgttcgacgtcttccccttctggaagaagcag
gtcaagctgctctccacctacgccgccgcgccgcgcgacctggccgaggcgctggagctg
atccgggcccggcgggtgccggtggaggacctgatcacccaccgtctgccgctcgccgag
acgcagaagggcttcgagctgaccgccgccggcggcgactcgatgaaggtcatcatcgaa
ccccagcgctga

DBGET integrated database retrieval system