KEGG   Oceanithermus profundus: Ocepr_0828Help
Entry
Ocepr_0828        CDS       T01369                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
opr  Oceanithermus profundus
Pathway
opr00620  Pyruvate metabolism
opr00680  Methane metabolism
opr01100  Metabolic pathways
opr01120  Microbial metabolism in diverse environments
opr01200  Carbon metabolism
Module
opr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:opr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ocepr_0828
  09102 Energy metabolism
   00680 Methane metabolism
    Ocepr_0828
Enzymes [BR:opr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Ocepr_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADR36285
UniProt: E4U870
LinkDB All DBs
Position
834739..837357
Genome map
AA seq 872 aa AA seqDB search
MTLPEALRRDVDRLGRALGEAIREVSGERLYELVEEVRARTKRLRQRPDDAERAALVRLV
ASLDLHRAEGLTRAFTSFFYLANLAESYHRVHTAADAKGEFARAARTLASWGVPPEEAAR
LARSMRLWLTFTAHPTEARRRTVRHHLERLRDALARGDRAAVRERVKLLWATEELRRTQP
TVEDEVKGALYYLPESLWSAQARLVERIEAALEQAFGKRFEAESPVRTRSWIGGDRDGNP
AVTPEVTAWAQDHARRLYVEHFCRELDELVRDLSVSERRLPVPRELREAAERALALIERA
PRFEGEPLRRYLMGVYYRLEHTLGSGPGAYGDAGELAGDLERLRRTLEAMGFSAFAARGV
RPLEEAARTFGLSFADLDLREEASEHREAVAELVAAAGLADDYPEWSDDRREAWLTGELA
SARPLAPVGYRPRGKALRRALGALEVWDGRGAYVVSMTKSPADLLEVLLLAREAGRYRPD
RGAPFDVVPLFETLADLDAAGRTVERLLANPVFRRQVEARGALEVMIGYSDSNKDAGYLA
ANWALYTAQQRIAEAARAAGVSVRFFHGRGTSTARGGGPAGRAIAALPVGTVGREIRITE
QGEALADKYAHPDLALRSLEETIAHLWLAAARDAGYGPEAAFAPEPAWVAAIEAAAARSA
QVYRELLGSEGFLAFFEQLTPIREIAALKIASRPVYRHGRIQEIRDLRAIPWVMAWTQVR
ANLPGWYGLGEGLSAIDPALLGEMHDGWPFFRSVLEGAELSLAKTDLEVTRGYLRLVDPE
LAGRFFSAIERAHEAALSTLEKARGRPLLADAPGLARSLELRNPYLDPINHLQIELLYRY
RRLPPESPDRESTTRALLSTILGIAAGMRNTG
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgcccgaggcgctccggcgcgacgtggaccggctgggccgggcgctgggggag
gcgatccgcgaggtcagcggcgaacgcctctacgaactggtcgaggaggtgcgcgcgcgc
accaagcggctgcggcagcggcccgacgacgccgagcgcgcggcgctggtgcgcctcgtc
gccagcctcgacctccaccgcgccgaagggctgacgcgggcgttcacgagcttcttctac
ctggccaacctggccgagtcctaccaccgggtgcacacggccgccgacgccaaaggcgag
tttgcgcgcgcggcccgtaccctggcctcctggggcgttccgccggaggaggccgcgcgc
ctggcgcgctcgatgcggctgtggctgacctttaccgcgcaccccaccgaagcgcgccgg
cgcaccgtgcgccaccacctcgagcgcctgcgcgacgcgctcgcgcgcggcgaccgggcg
gcggtgcgcgagcgggtcaagctgctgtgggccaccgaggagctgcgccgcacccagccc
accgtggaggacgaggtcaagggggcgctctactacctacccgaaagcctctggtcggcg
caagcgcgcctggtggagcggatcgaggccgcgctcgagcaggccttcgggaagcgcttc
gaggcggagagtccggtgcgcacccgcagctggatcggcggcgaccgcgacggcaacccg
gccgtcacccccgaggtcacggcctgggcgcaggaccacgcccgccgcctctacgtggag
cacttctgccgcgagctcgacgagctggtccgcgacctttcggtctccgagcgccggctg
ccggtcccgcgcgagctgcgcgaagcggcggagcgggcgctggcgctgatcgagcgcgcg
ccccgcttcgagggcgagccgctccggcgctacctcatgggcgtctactaccggctcgag
cacaccctgggttcggggcccggcgcctacggcgacgccggcgagctcgccggcgacctc
gagcggctgcggcggacgctcgaggcgatggggttctcggccttcgccgcgcgcggcgtg
cggcccctcgaagaggcggcgcgcaccttcgggctcagcttcgcggacctggacctgcgc
gaggaggcgagcgagcaccgcgaggccgtcgccgagctggtcgcggccgcggggctcgcg
gacgactaccccgagtggtccgacgaccgccgcgaggcctggctcaccggcgagctcgca
tcggcacgccccctcgcccccgtgggctaccgccctcgggggaaggccctgcggcgggcg
ctgggcgcgctcgaggtctgggacggccgcggggcctacgtggtgagcatgaccaagagt
cccgccgacctgctcgaggtgttgctgctggcgcgcgaagccggccgttaccgccccgac
cgcggcgcgcccttcgacgtggtgccgctcttcgagaccctggccgacctcgacgccgcg
ggccgcaccgtcgagcgcttgctcgccaacccggtcttccgccgccaggtcgaggcgcgg
ggggcgctcgaggtcatgatcggttactccgactccaacaaggacgcgggttacctcgcg
gccaactgggccctttacaccgcccagcagcgcatcgccgaggccgcccgggccgccggc
gtcagcgtccgcttctttcacggtcgcggcacctccacggcgcgcggcggcggtcccgcg
gggcgcgccatcgcggcgctgccggtgggcacggtggggcgcgagatccgcatcaccgag
cagggggaggccctggccgacaagtacgcccaccccgacctggcgttgcgcagcctggaa
gagacgatcgcgcacctctggctggccgcggcgcgcgacgccgggtacggccccgaggcc
gcctttgcgccagagccggcctgggtcgcggccatcgaggccgccgccgcccgctcggcg
caggtctaccgcgaactcctggggtcggagggttttctcgcctttttcgagcagctcacc
cccatccgcgagatcgccgcgctcaagatcgcctcgcgcccggtctaccgccacggccgc
attcaggaaatccgcgacctgcgggccattccctgggtcatggcctggacccaggtgcgc
gccaaccttccggggtggtacggcctgggcgaggggctgtcggccatcgacccggccctc
ctcggcgagatgcacgacggatggcccttctttcgaagcgtgctcgagggcgcggagctc
tcgttggcgaagaccgacctcgaggtgacccgcggctacctccgcctggtcgatcccgag
ctggccggacgcttcttctccgcgatcgagcgggcccacgaggccgccctttccactctg
gagaaggcccgcggccggcccctgctcgcggacgccccgggactcgcccgcagcctggag
ctgcgcaacccctacctcgacccgatcaaccacctgcagatcgagctgctctaccgctac
cgccggctgccgcccgagagccccgaccgcgaatcgacgacgcgggcgttgctgtcgacc
atcctgggcatcgccgcggggatgcgcaataccggctag

DBGET integrated database retrieval system