KEGG   Oceanithermus profundus: Ocepr_1794Help
Entry
Ocepr_1794        CDS       T01369                                 

Definition
(GenBank) Arginine kinase
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
opr  Oceanithermus profundus
Pathway
opr00330  Arginine and proline metabolism
opr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:opr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Ocepr_1794
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:opr04147]
    Ocepr_1794
Enzymes [BR:opr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     Ocepr_1794
Exosome [BR:opr04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   Ocepr_1794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-ProteinID: ADR37246
UniProt: E4U9T2
LinkDB All DBs
Position
1807082..1808104
Genome map
AA seq 340 aa AA seqDB search
MTLPNPQGGSLLARYLTPEVWEQLKDRETRYGVRLEHVVASGLKNPDSAVGVYAGDEESY
TLFAPLFDPIIADYHGFGPEARHESDLEPAHLNAPNPDPEGRYVVSTRIRVARNLCCFPF
GSALTRRERRIVEATVVRALEDLSGELAGSYHPLYAMDRATRERLIQSHFLFKEGDRFLK
AAGLNRDWPDARGIFHNPDKTFLVWVNEEDQLRIISMEPGANLQRVFARLTRALAELERR
LTFAFSERLGYLTSCPTNLGTAMRASVHVRLPGLAADEARLKALAAKHGLQVRGTHGEHS
QSEGAVYDVSNKQRLGITEVEAVRRLAEGVAALIAAEQRT
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaccctccccaaccctcagggcggctcgctgctcgcccgctacctgacccccgaggtc
tgggaacaactcaaagaccgcgagacccgctacggcgtgcggctcgagcacgtcgttgcc
tcggggctcaagaaccccgacagcgccgtgggcgtctacgccggcgacgaggaaagttac
accctcttcgcccccctcttcgacccgatcatcgccgactaccacggcttcggaccggaa
gcccggcacgaaagcgacctcgagcccgcccacctgaacgcccccaaccccgaccccgag
ggccgctacgtcgtctccacccgcatccgcgtggcccgcaacctctgctgcttccccttc
ggctccgcgctcacccggcgcgagcggcgcatcgtcgaggcgaccgtggtgcgcgccctc
gaggatctttccggcgagctggcgggcagctaccatccgctttacgcgatggaccgggcc
accagggagcggctgatccagagtcacttcctcttcaaggagggcgaccgcttccttaag
gccgcggggctgaaccgcgactggcccgacgcccgcggcatcttccacaacccggacaag
accttcctcgtctgggtgaacgaggaggaccagctgcgcatcatctcgatggagcccggg
gccaacctgcagcgcgtcttcgcccggctgacgcgggcgctggccgagctggagcgccgc
ctgacctttgcattctccgagcgcctcggctacctgaccagctgccccaccaacctgggc
accgccatgcgcgccagcgtccacgtccgcctgcccgggctggcggcggacgaagcgcgg
ctgaaggccctcgccgcaaagcacggcctgcaggtgcgcggcacccacggggagcactcg
caaagcgagggcgcggtctacgacgtttccaacaagcagcggctggggatcaccgaggtg
gaggccgtgcggcggctggccgaaggggtggccgcgctgatcgcggcggagcagcggact
taa

DBGET integrated database retrieval system